Q16595 FRDA_HUMAN

Gene name: FXN
Protein name: Frataxin, mitochondrial

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cell death GO:0008219
- cell population proliferation GO:0008283
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- embryo development GO:0009790
- generation of precursor metabolites and energy GO:0006091
- growth GO:0040007
- homeostatic process GO:0042592
- nervous system process GO:0050877
- protein maturation GO:0051604
- response to stress GO:0006950
- signal transduction GO:0007165
- small molecule metabolic process GO:0044281
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q8N6F7 GCSAM 0.87084 immune system process GO:0002376
signal transduction GO:0007165
2 O43897 TLL1 0.8065 anatomical structure development GO:0048856
cell differentiation GO:0030154
extracellular matrix organization GO:0030198
3 Q9HBI5 C3orf14 0.77032
4 P59510 ADAMTS20 0.74704 cell death GO:0008219
cell differentiation GO:0030154
extracellular matrix organization GO:0030198
...
5 Q6ZSC3 RBM43 0.74267
6 Q99677 LPAR4 0.74139 homeostatic process GO:0042592
signal transduction GO:0007165
7 Q8NBM4 UBAC2 0.68535 catabolic process GO:0009056
cell-cell signaling GO:0007267
protein transport GO:0015031
...
8 Q8ND76 CCNY 0.67368 cell cycle GO:0007049
cell division GO:0051301
cell-cell signaling GO:0007267
...
9 Q5MNV8 FBXO47 0.66474
10 Q9BY19 MS4A8 0.65938

                                           20                  40                  60                  80                 100
AA:                      MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRGLRTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAE
STMI:                    TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT                                                           
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................
DO_IUPRED2A:             ............D.DD..DDDDDDDDDD......D............DDDD.DDD.....DD.......................DD.DDDD..D.....
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............
CONSENSUS:                                                        DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............
CONSENSUS_MOBI:                                                   ...........................................................
RICH_[N]:                                                                         NqrglNqiwNvkkqsvylmN                       
RICH_[R]:                                                          RtdidatctpRRassnqR                                        
RICH_[NQ]:                                                                        NQrglNQiwNvkkQ                             

                                          120                 140                 160                 180                 200
AA:                      ETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDL
STMI:                                                                                                                        
DO_DISOPRED3:            ....................................................................................................
DO_IUPRED2A:             ......................................................DDD...........................................
DO_SPOTD:                ....................................................................................................
CONSENSUS:               ....................................................................................................
CONSENSUS_MOBI:          ....................................................................................................

                                   
AA:                      SSLAYSGKDA
STMI:                              
DO_DISOPRED3:            ......DDDD
DO_IUPRED2A:             ..........
DO_SPOTD:                .....DDDDD
CONSENSUS:               ......DDDD
CONSENSUS_MOBI:          ..........