Q8N6S5 AR6P6_HUMAN

Gene name: ARL6IP6
Protein name: ADP-ribosylation factor-like protein 6-interacting protein 6

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q8NFW8 CMAS 0.79685 cellular nitrogen compound metabolic process GO:0034641
small molecule metabolic process GO:0044281
2 A8MQB3 LINC02693 0.76787
3 Q5TEA3 C20orf194 0.7654
4 Q5VUJ9 EFCAB2 0.76508
5 P26006 ITGA3 0.74709 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell adhesion GO:0007155
...
6 Q96D70 R3HDM4 0.73697
7 Q69YL0 NCBP2AS2 0.73691
8 O95922 TTLL1 0.71923 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...
9 P28062 PSMB8 0.71291 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
...
10 Q86YD1 PTOV1 0.69791 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641

                                           20                  40                  60                  80                 100
AA:                      MSFAESGWRSALRRRGPGTPGPVARPSYSSFTQGDSWGEGEVDEEEGCDQVARDLRAEFSAGAWSEPRKRSVLPPDGNGSPVLPDKRNGIFPAAAGSRAQ
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDD..................DDDDDDDD...............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....
DO_IUPRED2A:             .......DDDDDDDDDDDDDDDDDDDDDDDD..DDDD.DDDDDDD..D.....................DDD.DDDDDDD...D................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................DDDDDDDDDDDDDDDDDDDD...............
RICH_[PR]:                       RsalRRRgPgtPgPvaRP                                                                          
RICH_[R]:                        RsalRRRgpgtpgpvaR                                                                           
RICH_[EG]:                                                GdswGEGEvdEEEG                                                     
RICH_[GP]:                     GwrsalrrrGPGtPGPvarP                                                                          
RICH_[GR]:                     GwRsalRRRGpGtpGpvaR                                                                           
RICH_fLPS_[E]:                                               wgEgEvdEEE                                                      
RICH_MOBI_[R]:                   RsalRRRgpgtpgpvaR                                                                           
RICH_MOBI_[EG]:                                           GdswGEGEvdEEEG                                                     
RICH_MOBI_[GR]:                GwRsalRRRGpGtpGpvaR                                                                           
RICH_fLPS_MOBI_[E]:                                          wgEgEvdEEE                                                      

                                          120                 140                 160                 180                 200
AA:                      PRRWPVQVLSILCSLLFAILLAFLLAIAYLIVKELHAENLKNEDDVDTGLLGFWTLLIISLTAGFSCCSFSWTVTYFDSFEPGMFPPTPLSPARFKKLTG
STMI:                              MMMMMMMMMMMMMMMMMMMMM                  MMMMMMMMMMMMMMMMMMMMM                              
DO_DISOPRED3:            ....................................................................................................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........................................................
CONSENSUS:               ..........                     ..................                     ..............................
CONSENSUS_MOBI:          ..........                     ..................                     ..............................

                                          220              
AA:                      HSFHMGYSMAILNGIVAALTVAWCLM
STMI:                        MMMMMMMMMMMMMMMMMMMMM 
DO_DISOPRED3:            ..........................
DO_IUPRED2A:             ..........................
DO_SPOTD:                ..........................
CONSENSUS:               ....                     .
CONSENSUS_MOBI:          ....                     .