Q8N8Y5 ZFP41_HUMAN

Gene name: ZFP41
Protein name: Zinc finger protein 41 homolog

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
- reproduction GO:0000003

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9BQ13 KCTD14 0.84967 cellular component assembly GO:0022607
protein-containing complex assembly GO:0065003
2 Q15560 TCEA2 0.82992 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
3 Q69YN2 CWF19L1 0.81198 cellular nitrogen compound metabolic process GO:0034641
mRNA processing GO:0006397
4 Q9Y5P2 CSAG2 0.80433
5 Q04912 MST1R 0.80005 anatomical structure development GO:0048856
cell population proliferation GO:0008283
cellular protein modification process GO:0006464
...
6 P42681 TXK 0.78625 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
...
7 Q8IY34 SLC15A3 0.78119 protein transport GO:0015031
transport GO:0006810
8 P49450 CENPA 0.77597 biological process involved in symbiotic interaction GO:0044403
cell cycle GO:0007049
cell division GO:0051301
...
9 Q8N6T7 SIRT6 0.77419 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
10 Q86WX3 RPS19BP1 0.7737

                                           20                  40                  60                  80                 100
AA:                      MEKPAGRKKKTPTPREEADVQKSALREEKVSGDRKPPERPTVPRKPRTEPCLSPEDEEHVFDAFDASFKDDFEGVPVFIPFQRKKPYECSECGRIFKHKT
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDD........................................................................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDDDDDDDDDDDDDDDDDDDDDDDD.......D....DD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................
RICH_[PR]:                                        ReekvsgdRkPPeRPtvPR                                                        
RICH_[K]:                  KpagrKKKtptpreeadvqK                                                                              
RICH_[P]:                                                   PPerPtvPrkPrtePclsP                                              
RICH_[R]:                                         ReekvsgdRkppeRptvpR                                                        
RICH_MOBI_[PR]:                                           RkPPeRPtvPRkPRteP                                                  
RICH_MOBI_[K]:             KpagrKKKtptpreeadvqK                                                                              
RICH_MOBI_[P]:                                              PPerPtvPrkPrtePclsP                                              
RICH_MOBI_[R]:                                    ReekvsgdRkppeRptvpR                                                        

                                          120                 140                 160                 180  
AA:                      DHIRHQRVHTGEKPFKCAQCGKAFRHSSDVTKHQRTHTGEKPFKCGECGKAFNCGSNLLKHQKTHTGEKPYECTHCGKAFAYSSCLIRHQKRHPRKKP
STMI:                                                                                                                      
DO_DISOPRED3:            ................................................................................................DD
DO_IUPRED2A:             DDDDDDDDD..................DDDDDDDDDD.......................................................DDDDDD
DO_SPOTD:                DD........................DDD......................................................DDDDDDDDDDDDDDD
CONSENSUS:               DD.........................DD...............................................................DDDDDD
CONSENSUS_MOBI:          ..................................................................................................