Q8NAQ8 YP023_HUMAN
Protein name: Putative uncharacterized protein FLJ34945
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | B1APH4 | ZNF487 | 0.93702 | |
2 | Q9NRG7 | SDR39U1 | 0.90483 | |
3 | O75078 | ADAM11 | 0.87338 | signal transduction GO:0007165 |
4 | K9M1U5 | IFNL4 | 0.86796 | cellular protein modification process GO:0006464 immune system process GO:0002376 response to stress GO:0006950 ... |
5 | Q9BTK2 | n/a | 0.8548 | |
6 | P59051 | BRWD1-AS2 | 0.84706 | |
7 | Q8WTV1 | THAP3 | 0.83696 | |
8 | Q86VU5 | COMTD1 | 0.83669 | |
9 | Q86V25 | VASH2 | 0.81927 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell differentiation GO:0030154 ... |
10 | P34820 | BMP8B | 0.8173 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular protein modification process GO:0006464 ... |
20 40 60 80 100 AA: MYSVLQLLKCLCSCWRKGPEGRRFQTEAAVCARPAWSPHPAGASEALGALPPPRQLVEKRRVSPPRRLDQSGRDGGAVAKCSLSRGLSPPGWTGRSLLRP STMI: DO_DISOPRED3: D................................................................................................... DO_IUPRED2A: .........................................DDDDDDDDDD..DDDDDDDDDDDDDDDDDDDDD.....D.................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................... CONSENSUS: D........................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....D.................... CONSENSUS_MOBI: ......................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....... RICH_[PR]: PPPRqlvekRRvsPPRR RICH_[R]: RqlvekRRvsppRRldqsgR RICH_fLPS_[R]: RqlvekRRvsppRRldqsgR RICH_MOBI_[R]: RqlvekRRvsppRRldqsgR
120 AA: WGSAAVLGSRAALACVLRPSRGVMPATIQSRR STMI: DO_DISOPRED3: ........................DDDDDDDD DO_IUPRED2A: .........................DDDDDDD DO_SPOTD: ....................DDDDDDDDDDDD CONSENSUS: ........................DDDDDDDD CONSENSUS_MOBI: ................................