Q9BTK2 YX002_HUMAN

Protein name: Putative uncharacterized protein LOC642776

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 K9M1U5 IFNL4 0.99597 cellular protein modification process GO:0006464
immune system process GO:0002376
response to stress GO:0006950
...
2 Q9NVD3 SETD4 0.94108 cellular protein modification process GO:0006464
3 Q92914 FGF11 0.89288 anatomical structure development GO:0048856
cell-cell signaling GO:0007267
signal transduction GO:0007165
4 O75078 ADAM11 0.89008 signal transduction GO:0007165
5 Q9UNQ2 DIMT1 0.87827 cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
6 Q8NAQ8 n/a 0.8548
7 A8K010 LINC00473 0.84555 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
8 Q86V25 VASH2 0.84491 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...
9 Q9NUL7 DDX28 0.81632 cellular component assembly GO:0022607
protein-containing complex assembly GO:0065003
ribonucleoprotein complex assembly GO:0022618
...
10 P33681 CD80 0.81534 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell adhesion GO:0007155
...

                                           20                  40               
AA:                      MEGGMAAYPVATRESRCRRGRIGVQPSPERRSEVVGPFPLARSLS
STMI:                                                                 
DO_DISOPRED3:            DDDDD.......................................D
DO_IUPRED2A:             .DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....D
CONSENSUS_MOBI:          .................DDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[R]:                            ResRcRRgRigvqpspeRR              
RICH_fLPS_[R]:                      tResRcRRgRigvqpspeRR              
RICH_MOBI_[R]:                            RRgRigvqpspeRR