K9M1U5 IFNL4_HUMAN
Gene name: IFNL4
Protein name: Interferon lambda-4
List of terms from Generic GO subset, which this protein is a part of:
- cellular protein modification process GO:0006464
- immune system process GO:0002376
- response to stress GO:0006950
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9BTK2 | n/a | 0.99597 | |
| 2 | Q9NVD3 | SETD4 | 0.93371 | cellular protein modification process GO:0006464 |
| 3 | Q9UNQ2 | DIMT1 | 0.88301 | cellular nitrogen compound metabolic process GO:0034641 ribosome biogenesis GO:0042254 |
| 4 | O75078 | ADAM11 | 0.86938 | signal transduction GO:0007165 |
| 5 | Q8NAQ8 | n/a | 0.86796 | |
| 6 | Q9NUL7 | DDX28 | 0.86377 | cellular component assembly GO:0022607 protein-containing complex assembly GO:0065003 ribonucleoprotein complex assembly GO:0022618 ... |
| 7 | Q92914 | FGF11 | 0.86367 | anatomical structure development GO:0048856 cell-cell signaling GO:0007267 signal transduction GO:0007165 |
| 8 | P33681 | CD80 | 0.86094 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
| 9 | O60762 | DPM1 | 0.85848 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 small molecule metabolic process GO:0044281 |
| 10 | Q9Y3A4 | RRP7A | 0.85651 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cellular component assembly GO:0022607 ... |
20 40 60 80 100 AA: MRPSVWAAVAAGLWVLCTVIAAAPRRCLLSHYRSLEPRTLAAAKALRDRYEEEALSWGQRNCSFRPRRDPPRPSSCARLRHVARGIADAQAVLSGLHRSE STMI: SSSSSSSSSSSSSSSSSSSSS DO_DISOPRED3: DDDDDDDDDDDDDDDDDD.............................................DDD.................................. DO_IUPRED2A: ................................................................D..D......D......................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDD.............D.DDDDDDDDDDD..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............DDD.. CONSENSUS: ..........................................DDDDD......D......................... CONSENSUS_MOBI: ...............................................................................
120 140 160 AA: LLPGAGPILELLAAAGRDVAACLELARPGSSRKVPGAQKRRHKPRRADSPRCRKASVVFNLLRLLTWELRLAAHSGPCL STMI: DO_DISOPRED3: ..........................DDDDDDDDDDDDDDDD..................................... DO_IUPRED2A: ...............................DDDDDDDDDDDDDDDDD.D............................. DO_SPOTD: .....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................... CONSENSUS: ..........................DDDDDDDDDDDDDDDDDDDDDD............................... CONSENSUS_MOBI: .............................DDDDDDDDDDDDDDDDDDDD.............................. RICH_[R]: RpgssRkvpgaqkRRhkpRR RICH_fLPS_[R]: RpgssRkvpgaqkRRhkpRR RICH_MOBI_[R]: RkvpgaqkRRhkpRR