Q8NGA4 G32P1_HUMAN
Gene name: GPR32P1
Protein name: Putative G-protein coupled receptor GPR32P1
List of terms from Generic GO subset, which this protein is a part of:
- homeostatic process GO:0042592
- immune system process GO:0002376
- response to stress GO:0006950
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | Q9Y6K0 | CEPT1 | 0.88492 | biosynthetic process GO:0009058 |
2 | Q8IYN0 | ZNF100 | 0.88492 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
3 | Q9NYP9 | MIS18A | 0.70602 | cell cycle GO:0007049 cell division GO:0051301 cellular component assembly GO:0022607 ... |
4 | Q701N2 | KRTAP5-5 | 0.70129 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
5 | Q9H4E5 | RHOJ | 0.66161 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell morphogenesis GO:0000902 ... |
6 | Q6L8H1 | KRTAP5-4 | 0.65276 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
7 | Q14145 | KEAP1 | 0.62672 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
8 | Q6L8H4 | KRTAP5-1 | 0.59464 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
9 | Q6L8G5 | KRTAP5-10 | 0.57093 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
10 | Q6L8H2 | KRTAP5-3 | 0.56658 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
20 40 60 80 100 AA: MNGVSEGTRGCSDRQPGALTQGHSCSRKMNASRCLSEEVGSLRPLTMAVLSASFVVGVLGNGLVPWVTVFRMARTVSTVCFFHLALADFMLSLSLPILVY STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................................... DO_IUPRED2A: .....DDD............................................................................................ DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................ CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......... ........... . CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDD...................... ........... . RICH_[C]: CsrkmnasrC RICH_[CG]: GtrGCsdrqpGaltqGhsC
120 140 160 180 200 AA: YIVSRQWLLGEWACKLYTGFVFLTFSTSNCLLVLISVDRCISVLYPVWALNHRTEQRASWLAFGVWLLAAALCSAHLKFRTTRKWNGCMQCYLQFNLENE STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: ................ ..................... ..................... CONSENSUS_MOBI: ................ ..................... .....................
220 240 260 AA: TAQMWTQEVFGRQMAVIMAHFLLGFLGPLAIIGTCAHLIRAKLLREGWVHANRPKRLLLVLVSALSAGSHLT STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: ........................................................................ DO_IUPRED2A: ........................................................................ DO_SPOTD: ........................................................................ CONSENSUS: ............. ...................................... CONSENSUS_MOBI: ............. ......................................