Q8NHG7 SVIP_HUMAN

Gene name: SVIP
Protein name: Small VCP/p97-interacting protein

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cellular component assembly GO:0022607
- cellular protein modification process GO:0006464
- immune system process GO:0002376
- protein transport GO:0015031
- protein-containing complex assembly GO:0065003
- response to stress GO:0006950
- transport GO:0006810
- vesicle-mediated transport GO:0016192

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9H7B2 RPF2 0.65222 cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
protein-containing complex assembly GO:0065003
...
2 Q7L190 DPPA4 0.64936 anatomical structure development GO:0048856
3 Q15198 PDGFRL 0.63862
4 Q5H9U9 DDX60L 0.62511
5 O76021 RSL1D1 0.62478 cell death GO:0008219
cell differentiation GO:0030154
cellular nitrogen compound metabolic process GO:0034641
...
6 Q9NX58 LYAR 0.62437 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
7 Q9GZR5 ELOVL4 0.61961 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
small molecule metabolic process GO:0044281
8 Q13601 KRR1 0.60846 cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
9 Q96A08 H2BC1 0.59913 anatomical structure development GO:0048856
cell differentiation GO:0030154
cellular component assembly GO:0022607
...
10 P42127 ASIP 0.59864 biosynthetic process GO:0009058
cell-cell signaling GO:0007267
cellular nitrogen compound metabolic process GO:0034641
...

                                           20                  40                  60   
AA:                      MGLCFPCPGESAPPTPDLEEKRAKLAEAAERRQKEAASRGILDVQSVQEKRKKKEKIEKQIATSGPPPEGGLRWTVS
STMI:                                                                                                 
DO_DISOPRED3:            .....................................................D.....DD................
DO_IUPRED2A:             ..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......
CONSENSUS:               ..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDD....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[AE]:                        EsApptpdlEEkrAklAEAAErrqkEAA                                        
RICH_[AR]:                                    RAklAeAAeRRqkeAAsR                                      
RICH_[A]:                                      AklAeAAerrqkeAA                                        
RICH_[K]:                                                 KeaasrgildvqsvqeKrKKKeKieK                  
RICH_[R]:                                     RaklaeaaeRRqkeaasR                                      
RICH_[CP]:                  CfPCPgesaPPtP                                                             
RICH_[EK]:                                                               EKrKKKEKiE                   
RICH_[EP]:                      PgEsaPPtPdlEEkraklaE                                                  
RICH_[ER]:                                  EkRaklaEaaERRqkEaasR                                      
RICH_[IK]:                                                                KrKKKeKIeKqI                
RICH_fLPS_[K]:                                                  gildvqsvqeKrKKKeKieK                  
RICH_MOBI_[A]:                                    AeAAerrqkeAA                                        
RICH_MOBI_[K]:                                            KeaasrgildvqsvqeKrKKKeKieK                  
RICH_MOBI_[CP]:             CfPCPgesaPPtP                                                             
RICH_MOBI_[IK]:                                                  IldvqsvqeKrKKKeKIeKqI                
RICH_MOBI_[KV]:                                                     VqsVqeKrKK                        
RICH_fLPS_MOBI_[K]:                                             gildvqsvqeKrKKKeKieK