P42127 ASIP_HUMAN

Gene name: ASIP
Protein name: Agouti-signaling protein

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cell-cell signaling GO:0007267
- cellular nitrogen compound metabolic process GO:0034641
- generation of precursor metabolites and energy GO:0006091
- signal transduction GO:0007165
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q96A08 H2BC1 0.97172 anatomical structure development GO:0048856
cell differentiation GO:0030154
cellular component assembly GO:0022607
...
2 Q9NRQ5 SMCO4 0.96737
3 A0A1B0GTY4 TEX50 0.96188
4 P24844 MYL9 0.95766 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell differentiation GO:0030154
...
5 Q9Y324 FCF1 0.94331 cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
6 Q9Y291 MRPS33 0.92167 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
translation GO:0006412
7 Q6NW29 RWDD4 0.91941
8 Q92963 RIT1 0.91244 signal transduction GO:0007165
9 Q07325 CXCL9 0.90876 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...
10 Q9NWT1 PAK1IP1 0.88929 anatomical structure development GO:0048856
cell population proliferation GO:0008283
ribosome biogenesis GO:0042254
...

                                           20                  40                  60                  80                 100
AA:                      MDVTRLLLATLLVFLCFFTANSHLPPEEKLRDDRSLRSNSSVNLLDVPSVSIVALNKKSKQIGRKAAEKKRSSKKEASMKKVVRPRTPLSAPCVATRNSC
STMI:                    SSSSSSSSSSSSSSSSSSSSSS                                                                              
DO_DISOPRED3:            DDDDDDDDDDDDD...................................................DDDDDDDDDDDDDDDDDDDDDDDDDD..........
DO_IUPRED2A:             ............................DDDDD..............................DDDDDDDDDDDDDDDDDDD..................
DO_SPOTD:                DDDDDDDDDDDD.........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.
CONSENSUS:                                     ......DDDDD..............................DDDDDDDDDDDDDDDDDDDDDDDDDDD..........
CONSENSUS_MOBI:                                .......................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........
RICH_[K]:                                                                                KaaeKKrssKKeasmKK                   
RICH_fLPS_[K]:                                                                          rKaaeKKrssKKeasmKKvv                 
RICH_MOBI_[K]:                                                                           KaaeKKrssKKeasmKK                   
RICH_MOBI_[KV]:                                                                                   KKeasmKKVV                 
RICH_fLPS_MOBI_[K]:                                                                   igrKaaeKKrssKKeasmKK                   

                                          120        
AA:                      KPPAPACCDPCASCQCRFFRSACSCRVLSLNC
STMI:                                                    
DO_DISOPRED3:            ................................
DO_IUPRED2A:             ................................
DO_SPOTD:                ................................
CONSENSUS:               ................................
CONSENSUS_MOBI:          ................................