Q8TDM0 BCAS4_HUMAN
Gene name: BCAS4
Protein name: Breast carcinoma-amplified sequence 4
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9NRM0 | SLC2A9 | 0.70109 | cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 transmembrane transport GO:0055085 ... |
| 2 | Q6ZSN1 | n/a | 0.69686 | |
| 3 | Q8NE28 | STKLD1 | 0.69569 | |
| 4 | P60321 | NANOS2 | 0.68035 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 5 | Q69YL0 | NCBP2AS2 | 0.67277 | |
| 6 | Q86X59 | LINC02875 | 0.66918 | |
| 7 | P62136 | PPP1CA | 0.66883 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
| 8 | O15553 | MEFV | 0.66784 | catabolic process GO:0009056 cellular component assembly GO:0022607 cellular protein modification process GO:0006464 ... |
| 9 | Q9BXM7 | PINK1 | 0.66649 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 10 | P48546 | GIPR | 0.664 | anatomical structure development GO:0048856 cell-cell signaling GO:0007267 generation of precursor metabolites and energy GO:0006091 ... |
20 40 60 80 100 AA: MQRTGGGAPRPGRNHGLPGSLRQPDPVALLMLLVDADQPEPMRSGARELALFLTPEPGAEAKEVEETIEGMLLRLEEFCSLADLIRSDTSQILEENIPVL STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDD.......................DDDDDD......D.....DD.................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDD............................................................................... RICH_[G]: GGGaprpGrnhGlpG RICH_[R]: RtgggapRpgRnhglpgslR RICH_[GP]: GGGaPrPGrnhGlPGslrqPdP RICH_[GR]: RtGGGapRpGRnhGlpGslR RICH_[LP]: PgrnhgLPgsLrqPdPvaLL RICH_fLPS_[G]: GGGaprpGrnhGlpG RICH_MOBI_[G]: GGGaprpGrnhGlpG
120 140 160 180 200 AA: KAKLTEMRGIYAKVDRLEAFVKMVGHHVAFLEADVLQAERDHGAFPQALRRWLGSAGLPSFRNVECSGTIPARCNLRLPGSSDSPASASQVAGITEVTCT STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: ..............................................................................DDDDDDDDDDDDDDDD.DDDDD CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
AA: GARDVRAAHTV STMI: DO_DISOPRED3: ........DDD DO_IUPRED2A: ........... DO_SPOTD: DDDDDDDDDDD CONSENSUS: ........DDD CONSENSUS_MOBI: ...........