Q8WV19 SFT2A_HUMAN
Gene name: SFT2D1
Protein name: Vesicle transport protein SFT2A
List of terms from Generic GO subset, which this protein is a part of:
- protein transport GO:0015031
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P49368 | CCT3 | 0.91806 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
| 2 | P31639 | SLC5A2 | 0.83205 | carbohydrate metabolic process GO:0005975 transmembrane transport GO:0055085 transport GO:0006810 |
| 3 | A6NJ78 | METTL15 | 0.73106 | cellular nitrogen compound metabolic process GO:0034641 ribosome biogenesis GO:0042254 |
| 4 | Q13277 | STX3 | 0.65815 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 5 | A4D256 | CDC14C | 0.59655 | cell cycle GO:0007049 cell division GO:0051301 cellular component assembly GO:0022607 ... |
| 6 | P0C7V9 | METTL15P1 | 0.59017 | cellular nitrogen compound metabolic process GO:0034641 ribosome biogenesis GO:0042254 |
| 7 | P43630 | KIR3DL2 | 0.56321 | cell death GO:0008219 immune system process GO:0002376 response to stress GO:0006950 |
| 8 | Q5SWX8 | ODR4 | 0.5618 | |
| 9 | Q92552 | MRPS27 | 0.52835 | biosynthetic process GO:0009058 cell population proliferation GO:0008283 cellular nitrogen compound metabolic process GO:0034641 ... |
| 10 | P13010 | XRCC5 | 0.52737 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
20 40 60 80 100 AA: MEKLRRVLSGQDDEEQGLTAQVLDASSLSFNTRLKWFAICFVCGVFFSILGTGLLWLPGGIKLFAVFYTLGNLAALASTCFLMGPVKQLKKMFEATRLLA STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM MMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDD............................................................................ DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDD............ ..... .............. CONSENSUS_MOBI: .................................... ..... .............. RICH_[DQ]: QDDeeQgltaQvlD
120 140 AA: TIVMLLCFIFTLCAALWWHKKGLAVLFCILQFLSMTWYSLSYIPYARDAVIKCCSSLLS STMI: MMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: ........................................................... DO_IUPRED2A: ........................................................... DO_SPOTD: ........................................................... CONSENSUS: .... ................ CONSENSUS_MOBI: .... ................