P0C7V9 ME15P_HUMAN
Gene name: METTL15P1
Protein name: Putative methyltransferase-like protein 15P1
List of terms from Generic GO subset, which this protein is a part of:
- cellular nitrogen compound metabolic process GO:0034641
- ribosome biogenesis GO:0042254
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q96SR6 | ZNF382 | 0.80728 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 2 | Q9Y3C7 | MED31 | 0.79659 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell population proliferation GO:0008283 ... |
| 3 | Q9NVH2 | INTS7 | 0.75659 | biosynthetic process GO:0009058 cell cycle GO:0007049 cellular nitrogen compound metabolic process GO:0034641 ... |
| 4 | Q3MHD2 | LSM12 | 0.73319 | |
| 5 | O60437 | PPL | 0.71399 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 ... |
| 6 | Q9Y6H3 | ATP23 | 0.70536 | cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 DNA metabolic process GO:0006259 ... |
| 7 | A8MTZ0 | BBIP1 | 0.65582 | cellular component assembly GO:0022607 protein transport GO:0015031 transport GO:0006810 |
| 8 | O94886 | TMEM63A | 0.65276 | immune system process GO:0002376 transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 9 | P43630 | KIR3DL2 | 0.64262 | cell death GO:0008219 immune system process GO:0002376 response to stress GO:0006950 |
| 10 | A8K554 | ZNF815P | 0.62403 |
20 40 60 80 100 AA: MLRYPYFCRMYKECLSCWLESGIPNLGVWPKRIHTTAEKYREYEAREQTDQTQVQELHRSQDRDFETMAKLHIPVMVDEVVHCLSPQKGQIFLDMTFGSG STMI: DO_DISOPRED3: D...................................................DDDDDDDDDDDD.................................... DO_IUPRED2A: .......................................DDDDDDD.DDDDDDDDDDDDD........................................ DO_SPOTD: ............................................DDDDDDDDDDDDDDDDDDDDDDDD................................ CONSENSUS: ............................................DDDDDDDDDDDDDDDDDDDD.................................... CONSENSUS_MOBI: .................................................................................................... RICH_[Q]: QtdQtQvQelhrsQ RICH_[DQ]: DQtQvQelhrsQDrD RICH_fLPS_[Q]: eQtdQtQvQelhrsQ
120 140 160 180 200 AA: GHTKAILQKESDIVLYALDRDPTAYALAEHLSELYPKQIRAMLGQFSQAEALLMKAGVQPGTFDGVLMDLGCSSMQLDTPERGSSLRKDGPLDIRMDGGR STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: ................................................................................D.DDDDDDDDD......... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
220 AA: NISSLCYLYTERLTTAIYLYCHQDFPGSSHICEQ STMI: DO_DISOPRED3: .................................. DO_IUPRED2A: .................................. DO_SPOTD: ..........................DDDDDDDD CONSENSUS: .................................. CONSENSUS_MOBI: ..................................