Q8WWF6 DNJB3_HUMAN

Gene name: DNAJB3
Protein name: DnaJ homolog subfamily B member 3

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q12836 ZP4 0.63059 cell adhesion GO:0007155
cell population proliferation GO:0008283
immune system process GO:0002376
...
2 P78543 BTG2 0.59623 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
3 Q8IUN9 CLEC10A 0.56471 immune system process GO:0002376
response to stress GO:0006950
signal transduction GO:0007165
...
4 Q8NA42 ZNF383 0.51562 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
5 Q86Y78 LYPD6 0.51435 cell-cell signaling GO:0007267
signal transduction GO:0007165
6 Q8TD20 SLC2A12 0.4905 transmembrane transport GO:0055085
transport GO:0006810
7 Q6QN14 USP17L6P 0.46843 catabolic process GO:0009056
cell death GO:0008219
cellular protein modification process GO:0006464
8 P54756 EPHA5 0.46167 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
9 Q9Y297 BTRC 0.43222 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
...
10 P37058 HSD17B3 0.42965 anatomical structure development GO:0048856
biosynthetic process GO:0009058
reproduction GO:0000003
...

                                           20                  40                  60                  80                 100
AA:                      MVDYYEVLDVPRQASSEAIKKAYRKLALKWHPDKNPENKEEAERRFKQVAEAYEVLSDAKKRDIYDRYGEAGAEGGCTGGRPFEDPFEYVFSFRDPADVF
STMI:                                                                                                                        
DO_DISOPRED3:            ...........................................................................DDDDDDDDDD...............
DO_IUPRED2A:             .................................DD.DDDDDDDD...............................D........................
DO_SPOTD:                .....................................................................DDDDDDDDDDDDDDDDDD.............
CONSENSUS:               ...........................................................................DDDDDDDDDD...............
CONSENSUS_MOBI:          ....................................................................................................

                                          120                 140               
AA:                      REFFGGQDPFSFDLLGNPLENILGGSEELLGKQKQSVCTPFLCLQ
STMI:                                                                 
DO_DISOPRED3:            .................DDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             .........................D...................
DO_SPOTD:                .......DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               .................DDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          .............................................
RICH_[CL]:                                           LLgkqkqsvCtpfLCL 
RICH_[CQ]:                                               QkQsvCtpflClQ