Q8WY50 PLAC4_HUMAN

Gene name: PLAC4
Protein name: Placenta-specific protein 4

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9NUM3 SLC39A9 0.90771 transport GO:0006810
2 Q96MU6 ZNF778 0.79262
3 Q6ZSB3 LINC00299 0.73994
4 Q03924 ZNF117 0.70711 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
5 Q8IW03 SIAH3 0.70711 anatomical structure development GO:0048856
catabolic process GO:0009056
protein targeting GO:0006605
...
6 Q96HV5 TMEM41A 0.70353
7 Q8N7P3 CLDN22 0.67572 cell adhesion GO:0007155
cell junction organization GO:0034330
cellular component assembly GO:0022607
8 Q96IR2 ZNF845 0.67256
9 A0A1B0GVZ9 TMEM269 0.66896
10 P28069 POU1F1 0.64212 anatomical structure development GO:0048856
biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
...

                                           20                  40                  60                  80                 100
AA:                      MKELLRLKHCKHLLTTHVHSPWTPSLTLTPSLLTLDTLTHPRHRHSSPWTPHSAPWTPSLTLDTFTHPDTLTHPGHPHSPWIPSLLTLDTLTHPGYPHSS
STMI:                                                                                                                        
DO_DISOPRED3:            DD..................................................................D.DDDD..DD......................
DO_IUPRED2A:             .....................................D.....DD..DDDD...............DDDDD.DD..........................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DD...................................D.....DDDDDDDD...............DDDDDDDDDDDD......................
CONSENSUS_MOBI:          ....................................................................................................
RICH_[H]:                                                                                  HpdtltHpgH                        

                                          120                 140          
AA:                      PWTLSLTLTPSILTLDSLTPHPGLPHSSPWTPSLLILDTLTQPGHPHSSP
STMI:                                                                      
DO_DISOPRED3:            .......................D........DDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ................DDD...DD................DDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               ................DDDDDDDD........DDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ..................................................