Q92982 NINJ1_HUMAN
Gene name: NINJ1
Protein name: Ninjurin-1
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell adhesion GO:0007155
- growth GO:0040007
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P46089 | GPR3 | 0.75054 | cell cycle GO:0007049 homeostatic process GO:0042592 reproduction GO:0000003 ... |
| 2 | Q9UHF5 | IL17B | 0.70278 | cell-cell signaling GO:0007267 immune system process GO:0002376 response to stress GO:0006950 |
| 3 | O43414 | ERI3 | 0.67748 | catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 DNA metabolic process GO:0006259 ... |
| 4 | Q9UPM9 | B9D1 | 0.65891 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular component assembly GO:0022607 ... |
| 5 | Q9NV96 | TMEM30A | 0.65891 | anatomical structure development GO:0048856 cell differentiation GO:0030154 immune system process GO:0002376 ... |
| 6 | Q6SZW1 | SARM1 | 0.63406 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 7 | A4D126 | CRPPA | 0.58935 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 8 | Q5SWW7 | C10orf55 | 0.58308 | |
| 9 | Q5JXX5 | n/a | 0.56794 | |
| 10 | Q5UE93 | PIK3R6 | 0.56369 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
20 40 60 80 100 AA: MDSGTEEYELNGGLPPGTPGSPDASPARWGWRHGPINVNHYASKKSAAESMLDIALLMANASQLKAVVEQGPSFAFYVPLVVLISISLVLQIGVGVLLIF STMI: MMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................... DO_IUPRED2A: .DD..DDDDDDDDDDDDDDDDDDDDDD......................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................................ CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDD...................................................... RICH_[PW]: PPgtPgsPdasParWgW RICH_[EG]: GtEEyElnGG RICH_[GP]: GteeyelnGGlPPGtPGsPdasParwG RICH_[GW]: GGlppGtpGspdasparWGW RICH_MOBI_[GP]: GlPPGtPGsP
120 140 AA: LVKYDLNNPAKHAKLDFLNNLATGLVFIIVVVNIFITAFGVQKPLMDMAPQQ STMI: M MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: ...........................................DDDDDDDDD DO_IUPRED2A: .................................................... DO_SPOTD: ..........................................DDDDDDDDDD CONSENSUS: ................... ..DDDDDDDDD CONSENSUS_MOBI: ................... ...........