Q92982 NINJ1_HUMAN

Gene name: NINJ1
Protein name: Ninjurin-1

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell adhesion GO:0007155
- growth GO:0040007

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P46089 GPR3 0.75054 cell cycle GO:0007049
homeostatic process GO:0042592
reproduction GO:0000003
...
2 Q9UHF5 IL17B 0.70278 cell-cell signaling GO:0007267
immune system process GO:0002376
response to stress GO:0006950
3 O43414 ERI3 0.67748 catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
DNA metabolic process GO:0006259
...
4 Q9UPM9 B9D1 0.65891 anatomical structure development GO:0048856
cell differentiation GO:0030154
cellular component assembly GO:0022607
...
5 Q9NV96 TMEM30A 0.65891 anatomical structure development GO:0048856
cell differentiation GO:0030154
immune system process GO:0002376
...
6 Q6SZW1 SARM1 0.63406 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
7 A4D126 CRPPA 0.58935 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
8 Q5SWW7 C10orf55 0.58308
9 Q5JXX5 n/a 0.56794
10 Q5UE93 PIK3R6 0.56369 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...

                                           20                  40                  60                  80                 100
AA:                      MDSGTEEYELNGGLPPGTPGSPDASPARWGWRHGPINVNHYASKKSAAESMLDIALLMANASQLKAVVEQGPSFAFYVPLVVLISISLVLQIGVGVLLIF
STMI:                                                                                                    MMMMMMMMMMMMMMMMMMMM
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................................
DO_IUPRED2A:             .DD..DDDDDDDDDDDDDDDDDDDDDD.........................................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............................................                    
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDD......................................................                    
RICH_[PW]:                             PPgtPgsPdasParWgW                                                                     
RICH_[EG]:                  GtEEyElnGG                                                                                       
RICH_[GP]:                  GteeyelnGGlPPGtPGsPdasParwG                                                                      
RICH_[GW]:                          GGlppGtpGspdasparWGW                                                                     
RICH_MOBI_[GP]:                      GlPPGtPGsP                                                                              

                                          120                 140        
AA:                      LVKYDLNNPAKHAKLDFLNNLATGLVFIIVVVNIFITAFGVQKPLMDMAPQQ
STMI:                    M                   MMMMMMMMMMMMMMMMMMMMM           
DO_DISOPRED3:            ...........................................DDDDDDDDD
DO_IUPRED2A:             ....................................................
DO_SPOTD:                ..........................................DDDDDDDDDD
CONSENSUS:                ...................                     ..DDDDDDDDD
CONSENSUS_MOBI:           ...................                     ...........