Q93077 H2A1C_HUMAN

Gene name: H2AC6
Protein name: Histone H2A type 1-C

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cell population proliferation GO:0008283
- cellular nitrogen compound metabolic process GO:0034641
- chromosome organization GO:0051276

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q16881 TXNRD1 0.70789 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell population proliferation GO:0008283
...
2 Q96MM3 ZFP42 0.67246 anatomical structure development GO:0048856
cell cycle GO:0007049
reproduction GO:0000003
3 P48539 PCP4 0.65467 anatomical structure development GO:0048856
cell differentiation GO:0030154
signal transduction GO:0007165
4 Q71UI9 H2AZ2 0.65054 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
chromosome organization GO:0051276
5 Q86YW0 PLCZ1 0.61848 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
6 O75367 MACROH2A1 0.61746 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
7 Q9HAH1 ZNF556 0.61372
8 A6NIV6 LRRIQ4 0.60847
9 P39748 FEN1 0.607 biosynthetic process GO:0009058
catabolic process GO:0009056
cell cycle GO:0007049
...
10 Q9Y6Q3 ZFP37 0.60387 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641

                                           20                  40                  60                  80                 100
AA:                      MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGR
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDD...................................................................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDD..D......................................................D.D....DD.................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDD.............................................................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDD................................................................................
CONSENSUS_MOBI:          DDDDDDDDDDDDDD......................................................................................
RICH_[AK]:                    KqggKArAKAK                                                                                    
RICH_[K]:                     KqggKaraKaK                                                                                    
RICH_[GK]:                 GrGKqGGKaraKaK                                                                                    
RICH_MOBI_[GK]:              GKqGGKaraK                                                                                      

                                          120          
AA:                      VTIAQGGVLPNIQAVLLPKKTESHHKAKGK
STMI:                                                  
DO_DISOPRED3:            ....................DDDDDDDDDD
DO_IUPRED2A:             ...................DD.DDDDDDDD
DO_SPOTD:                ..................DDDDDDDDDDDD
CONSENSUS:               ...................DDDDDDDDDDD
CONSENSUS_MOBI:          ...............DDDDDDDDDDDDDDD
RICH_[HK]:                                  KtesHHKaKgK
RICH_MOBI_[K]:                             KKteshhKaKgK
RICH_MOBI_[HK]:                            KKtesHHKaKgK