Q71UI9 H2AV_HUMAN
Gene name: H2AZ2
Protein name: Histone H2A.V
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- chromosome organization GO:0051276
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q5VTE0 | EEF1A1P5 | 0.84156 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412 |
| 2 | A0PJW8 | DAPL1 | 0.83874 | catabolic process GO:0009056 cell death GO:0008219 cell differentiation GO:0030154 ... |
| 3 | P0C0S5 | H2AZ1 | 0.82013 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 |
| 4 | Q8NI60 | COQ8A | 0.81953 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 small molecule metabolic process GO:0044281 |
| 5 | Q9NXB9 | ELOVL2 | 0.79752 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 |
| 6 | Q9NRN5 | OLFML3 | 0.77442 | anatomical structure development GO:0048856 |
| 7 | Q9ULV1 | FZD4 | 0.76851 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
| 8 | Q9H6D3 | XKR8 | 0.76156 | anatomical structure development GO:0048856 cell death GO:0008219 membrane organization GO:0061024 ... |
| 9 | Q9BTE7 | DCUN1D5 | 0.72424 | cellular protein modification process GO:0006464 |
| 10 | Q9NVR7 | TBCCD1 | 0.70384 | anatomical structure development GO:0048856 cell morphogenesis GO:0000902 |
20 40 60 80 100 AA: MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSL STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDD................................................................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDD.D.........DDDDDDDDDDDDDDDDD....................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDD........................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDD................................................................................. CONSENSUS_MOBI: DDD................................................................................................. RICH_[AK]: AgKdsgKAKA RICH_[K]: KagKdsgKaKaK RICH_[GK]: GGKaGKdsGK
120 AA: IKATIAGGGVIPHIHKSLIGKKGQQKTA STMI: DO_DISOPRED3: ................DDDDDDDDDDDD DO_IUPRED2A: .....................DD.DD.. DO_SPOTD: ....................DDDDDDDD CONSENSUS: ....................DDDDDDDD CONSENSUS_MOBI: ............................