Q71UI9 H2AV_HUMAN

Gene name: H2AZ2
Protein name: Histone H2A.V

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- chromosome organization GO:0051276

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q5VTE0 EEF1A1P5 0.84156 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
translation GO:0006412
2 A0PJW8 DAPL1 0.83874 catabolic process GO:0009056
cell death GO:0008219
cell differentiation GO:0030154
...
3 P0C0S5 H2AZ1 0.82013 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
chromosome organization GO:0051276
4 Q8NI60 COQ8A 0.81953 biosynthetic process GO:0009058
cellular protein modification process GO:0006464
small molecule metabolic process GO:0044281
5 Q9NXB9 ELOVL2 0.79752 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
small molecule metabolic process GO:0044281
6 Q9NRN5 OLFML3 0.77442 anatomical structure development GO:0048856
7 Q9ULV1 FZD4 0.76851 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell adhesion GO:0007155
...
8 Q9H6D3 XKR8 0.76156 anatomical structure development GO:0048856
cell death GO:0008219
membrane organization GO:0061024
...
9 Q9BTE7 DCUN1D5 0.72424 cellular protein modification process GO:0006464
10 Q9NVR7 TBCCD1 0.70384 anatomical structure development GO:0048856
cell morphogenesis GO:0000902

                                           20                  40                  60                  80                 100
AA:                      MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSL
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDD...................................................................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDD.D.........DDDDDDDDDDDDDDDDD.......................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDD...........................................................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDD.................................................................................
CONSENSUS_MOBI:          DDD.................................................................................................
RICH_[AK]:                    AgKdsgKAKA                                                                                     
RICH_[K]:                    KagKdsgKaKaK                                                                                    
RICH_[GK]:                 GGKaGKdsGK                                                                                        

                                          120            
AA:                      IKATIAGGGVIPHIHKSLIGKKGQQKTA
STMI:                                                
DO_DISOPRED3:            ................DDDDDDDDDDDD
DO_IUPRED2A:             .....................DD.DD..
DO_SPOTD:                ....................DDDDDDDD
CONSENSUS:               ....................DDDDDDDD
CONSENSUS_MOBI:          ............................