Q96A25 T106A_HUMAN
Gene name: TMEM106A
Protein name: Transmembrane protein 106A
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cell-cell signaling GO:0007267
- cellular protein modification process GO:0006464
- immune system process GO:0002376
- protein transport GO:0015031
- response to stress GO:0006950
- signal transduction GO:0007165
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | Q02363 | ID2 | 0.90348 |
anatomical structure development
GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
2 | Q8TAG5 | VSTM2A | 0.90286 |
cell differentiation
GO:0030154 cell population proliferation GO:0008283 |
3 | P15907 | ST6GAL1 | 0.90016 |
biosynthetic process
GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 ... |
4 | Q16445 | GABRA6 | 0.89443 |
cell-cell signaling
GO:0007267 nervous system process GO:0050877 signal transduction GO:0007165 ... |
5 | P41586 | ADCYAP1R1 | 0.89443 |
anatomical structure development
GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
6 | Q9NPH3 | IL1RAP | 0.89004 |
anatomical structure development
GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
7 | Q7Z7C7 | STRA8 | 0.88822 |
anatomical structure development
GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
8 | P59773 | MINAR2 | 0.87416 | |
9 | P28336 | NMBR | 0.87179 |
signal transduction
GO:0007165 |
10 | Q9ULD0 | OGDHL | 0.86824 |
carbohydrate metabolic process
GO:0005975 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
20 40 60 80 100
AA: MGKTFSQLGSWREDENKSILSSKPAIGSKAVNYSSTGSSKSFCSCVPCEGTADASFVTCPTCQGSGKIPQELEKQLVALIPYGDQRLKPKHTKLFVFLAV
STMI: MMMMMM
DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........................................................
DO_IUPRED2A: ....................................................................................................
DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................
CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....................................................
CONSENSUS_MOBI: ..............................................................................................
RICH_[S]: SilSSkpaigSkavnySStgSSkS
120 140 160 180 200
AA: LICLVTSSFIVFFLFPRSVIVQPAGLNSSTVAFDEADIYLNITNILNISNGNYYPIMVTQLTLEVLHLSLVVGQVSNNLLLHIGPLASEQMFYAVATKIR
STMI: MMMMMMMMMMMMMMM
DO_DISOPRED3: ....................................................................................................
DO_IUPRED2A: ....................................................................................................
DO_SPOTD: ....................................................................................................
CONSENSUS: .....................................................................................
CONSENSUS_MOBI: .....................................................................................
220 240 260
AA: DENTYKICTWLEIKVHHVLLHIQGTLTCSYLSHSEQLVFQSYEYVDCRGNASVPHQLTPHPP
STMI:
DO_DISOPRED3: ....................................................DDDDDDDDDD
DO_IUPRED2A: .......................................................DDDDDDD
DO_SPOTD: ......................................................DDDDDDDD
CONSENSUS: ......................................................DDDDDDDD
CONSENSUS_MOBI: ..............................................................