Q96FW1 OTUB1_HUMAN
Gene name: OTUB1
Protein name: Ubiquitin thioesterase OTUB1
List of terms from Generic GO subset, which this protein is a part of:
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- chromosome organization GO:0051276
- DNA metabolic process GO:0006259
- immune system process GO:0002376
- response to stress GO:0006950
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q96I23 | PYURF | 0.70711 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 |
| 2 | P06756 | ITGAV | 0.68117 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biological process involved in symbiotic interaction GO:0044403 ... |
| 3 | Q8NFK1 | GJC3 | 0.67594 | anatomical structure development GO:0048856 cell-cell signaling GO:0007267 nervous system process GO:0050877 |
| 4 | O15130 | NPFF | 0.63347 | anatomical structure development GO:0048856 cell-cell signaling GO:0007267 circulatory system process GO:0003013 ... |
| 5 | Q9Y3D9 | MRPS23 | 0.63195 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412 |
| 6 | Q07021 | C1QBP | 0.62731 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
| 7 | Q32P28 | P3H1 | 0.61274 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell population proliferation GO:0008283 ... |
| 8 | Q9H9Q2 | COPS7B | 0.60149 | biological process involved in symbiotic interaction GO:0044403 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
| 9 | Q8NA66 | CNBD1 | 0.59683 | |
| 10 | Q92637 | FCGR1B | 0.59494 | immune system process GO:0002376 response to stress GO:0006950 signal transduction GO:0007165 ... |
20 40 60 80 100 AA: MAAEEPQQQKQEPLGSDSEGVNCLAYDEAIMAQQDRIQQEIAVQNPLVSERLELSVLYKEYAEDDNIYQQKIKDLHKKYSYIRKTRPDGNCFYRAFGFSH STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDD.............................................................................. DO_IUPRED2A: DDDDDDDDDDDDDDDDDD.................................................................................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDD.............................................................................. CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDD.............................................................................. RICH_[EQ]: EEpQQQkQEplgsdsE RICH_MOBI_[EQ]: EEpQQQkQEplgsdsE
120 140 160 180 200 AA: LEALLDDSKELQRFKAVSAKSKEDLVSQGFTEFTIEDFHNTFMDLIEQVEKQTSVADLLASFNDQSTSDYLVVYLRLLTSGYLQRESKFFEHFIEGGRTV STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
220 240 260 AA: KEFCQQEVEPMCKESDHIHIIALAQALSVSIQVEYMDRGEGGTTNPHIFPEGSEPKVYLLYRPGHYDILYK STMI: DO_DISOPRED3: ....................................................................... DO_IUPRED2A: .........................................DDDDDDD....................... DO_SPOTD: ....................................................................... CONSENSUS: ....................................................................... CONSENSUS_MOBI: .......................................................................