Q96IM9 DYDC2_HUMAN

Gene name: DYDC2
Protein name: DPY30 domain-containing protein 2

List of terms from Generic GO subset, which this protein is a part of:
- cellular protein modification process GO:0006464
- chromosome organization GO:0051276

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 O15031 PLXNB2 0.88893 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
2 P05362 ICAM1 0.72656 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
...
3 P22557 ALAS2 0.65153 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
4 Q8ND71 GIMAP8 0.63065 cell death GO:0008219
5 Q8NCL4 GALNT6 0.62069 biosynthetic process GO:0009058
cellular protein modification process GO:0006464
6 Q9NWS0 PIH1D1 0.62069 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell death GO:0008219
...
7 O00311 CDC7 0.61517 biosynthetic process GO:0009058
cell cycle GO:0007049
cell division GO:0051301
...
8 P62280 RPS11 0.61497 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
9 A8MT65 ZNF891 0.60881
10 Q14541 HNF4G 0.5571 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...

                                           20                  40                  60                  80                 100
AA:                      METNYLKRCFGNCLAQALAEVAKVRPSDPIEYLAHWLYHYRKTAKAKEENREKKIHLQEEYDSSLKEMEMTEMLKQEEYQIQQNCEKCHKELTSETVSTK
STMI:                                                                                                                        
DO_DISOPRED3:            ....................................................................................................
DO_IUPRED2A:             ................................................DDDDDDDDDDDDDDD..DDDDD.DDD.DD.......DD...D.D......DD
DO_SPOTD:                .....................................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               .....................................................................DDDDDDDD.......DDDDDD.D......DD
CONSENSUS_MOBI:          ....................................................................................................
RICH_[K]:                                                                                                                   K

                                          120                 140                 160   
AA:                      KTIFMQEDTNPLEKEALKQEFLPGTSSLIPGMPQQVPPSESAGQIDQNFKMPQEINYKEAFQHEVAHEMPPGSKSPF
STMI:                                                                                                 
DO_DISOPRED3:            ...........D.......DDDDDDDDDDDDDDDDDDDDDDDDDDD....................D.DDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDD..DDDDDDDD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          .............................................................................
RICH_[PQ]:                                            PgmPQQvPPsesagQidQ                              
RICH_[K]:                KtifmqedtnpleKealK                                                           
RICH_[Q]:                                                 QQvppsesagQidQnfkmpQ                        
RICH_[EH]:                                                                         EafqHEvaHE         
RICH_[IQ]:                                                          QIdQnfkmpQeI