Q99527 GPER1_HUMAN
Gene name: GPER1
Protein name: G-protein coupled estrogen receptor 1
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- carbohydrate metabolic process GO:0005975
- cell cycle GO:0007049
- cell death GO:0008219
- cell differentiation GO:0030154
- cell population proliferation GO:0008283
- cell-cell signaling GO:0007267
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- chromosome organization GO:0051276
- circulatory system process GO:0003013
- DNA metabolic process GO:0006259
- homeostatic process GO:0042592
- immune system process GO:0002376
- membrane organization GO:0061024
- nervous system process GO:0050877
- protein transport GO:0015031
- response to stress GO:0006950
- signal transduction GO:0007165
- small molecule metabolic process GO:0044281
- transmembrane transport GO:0055085
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | A6NNB3 | IFITM5 | 0.70711 | anatomical structure development GO:0048856 embryo development GO:0009790 |
| 2 | O95755 | RAB36 | 0.6595 | protein transport GO:0015031 signal transduction GO:0007165 transport GO:0006810 |
| 3 | P61964 | WDR5 | 0.63372 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
| 4 | Q86U28 | ISCA2 | 0.62984 | cellular component assembly GO:0022607 protein maturation GO:0051604 small molecule metabolic process GO:0044281 |
| 5 | P61647 | ST8SIA6 | 0.59867 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
| 6 | Q9NZN1 | IL1RAPL1 | 0.59656 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 7 | Q9NZU1 | FLRT1 | 0.59537 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 8 | P55058 | PLTP | 0.59136 | biosynthetic process GO:0009058 reproduction GO:0000003 small molecule metabolic process GO:0044281 ... |
| 9 | A8K4G0 | CD300LB | 0.57735 | immune system process GO:0002376 response to stress GO:0006950 |
| 10 | O00116 | AGPS | 0.54453 | biosynthetic process GO:0009058 protein targeting GO:0006605 protein transport GO:0015031 ... |
20 40 60 80 100 AA: MDVTSQARGVGLEMYPGTAQPAAPNTTSPELNLSHPLLGTALANGTGELSEHQQYVIGLFLSCLYTIFLFPIGFVGNILILVVNISFREKMTIPDLYFIN STMI: MMMMMMMMMMMMMMMMMMMMMM MMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....DDD.............................................................. DO_IUPRED2A: .........................D.......................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDDDDDDDDDDD...................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....DDD........................ ............ CONSENSUS_MOBI: .............................................................. ............ RICH_[AT]: TAqpAApnTT
120 140 160 180 200 AA: LAVADLILVADSLIEVFNLHERYYDIAVLCTFMSLFLQVNMYSSVFFLTWMSFDRYIALARAMRCSLFRTKHHARLSCGLIWMASVSATLVPFTAVHLQH STMI: MMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: ............ ...................... ...... CONSENSUS_MOBI: ............ ...................... ......
220 240 260 280 300 AA: TDEACFCFADVREVQWLEVTLGFIVPFAIIGLCYSLIVRVLVRAHRHRGLRPRRQKALRMILAVVLVFFVCWLPENVFISVHLLQRTQPGAAPCKQSFRH STMI: MMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .................................................................DD................................. DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................... ....................... .................... CONSENSUS_MOBI: .................... ....................... ....................
320 340 360 AA: AHPLTGHIVNLAAFSNSCLNPLIYSFLGETFRDKLRLYIEQKTNLPALNRFCHAALKAVIPDSTEQSDVRFSSAV STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: ...............................................DDDDDDDDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: ........................................................................... DO_SPOTD: ..............................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ...... ....................DDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ...... ................................................