Q9BQ51 PD1L2_HUMAN
Gene name: PDCD1LG2
Protein name: Programmed cell death 1 ligand 2
List of terms from Generic GO subset, which this protein is a part of:
- cell adhesion GO:0007155
- cell population proliferation GO:0008283
- immune system process GO:0002376
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P39086 | GRIK1 | 0.81923 | anatomical structure development GO:0048856 cell-cell signaling GO:0007267 signal transduction GO:0007165 |
| 2 | Q9BY67 | CADM1 | 0.71027 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 cell adhesion GO:0007155 ... |
| 3 | P23515 | OMG | 0.70492 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 4 | Q5T9L3 | WLS | 0.68279 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell-cell signaling GO:0007267 ... |
| 5 | Q7Z5S9 | TMEM144 | 0.66927 | |
| 6 | P43121 | MCAM | 0.62166 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell adhesion GO:0007155 ... |
| 7 | Q7LBR1 | CHMP1B | 0.60084 | biological process involved in symbiotic interaction GO:0044403 cell cycle GO:0007049 cell division GO:0051301 ... |
| 8 | Q96LB1 | MRGPRX2 | 0.59481 | cell cycle GO:0007049 cell division GO:0051301 immune system process GO:0002376 ... |
| 9 | Q96IY1 | NSL1 | 0.5908 | cell cycle GO:0007049 cell division GO:0051301 chromosome organization GO:0051276 ... |
| 10 | Q9H3Z4 | DNAJC5 | 0.58124 | cell death GO:0008219 cell-cell signaling GO:0007267 immune system process GO:0002376 ... |
20 40 60 80 100 AA: MIFLLLMLSLELQLHQIAALFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHRERATLLEEQLPLGKASFHIPQVQVRDEGQY STMI: SSSSSSSSSSSSSSSSSSS DO_DISOPRED3: DDDDDDDDDDDDDD...................................................................................... DO_IUPRED2A: ...................................................................DDDD.DD.......................... DO_SPOTD: DDDDDDDDDD.......................................................................................... CONSENSUS: ................................................................................. CONSENSUS_MOBI: .................................................................................
120 140 160 180 200 AA: QCIIIYGVAWDYKYLTLKVKASYRKINTHILKVPETDEVELTCQATGYPLAEVSWPNVSVPANTSHSRTPEGLYQVTSVLRLKPPPGRNFSCVFWNTHVR STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .............................................................D...................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
220 240 260 AA: ELTLASIDLQSQMEPRTHPTWLLHIFIPFCIIAFIFIATVIALRKQLCQKLYSSKDTTKRPVTTTKREVNSAI STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .......................D.DDDDDDDDDDDDD............DDDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: ..........................................................DD.DDDDDD...... DO_SPOTD: ..........................DDDD...............DDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: .................... .........DDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: .................... ................................ RICH_fLPS_[T]: dTTkrpvTTT