Q9BQD1 MCHL2_HUMAN
Gene name: PMCHL2
Protein name: Putative pro-MCH-like protein 2
List of terms from Generic GO subset, which this protein is a part of:
- cell-cell signaling GO:0007267
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q16048 | PMCHL1 | 0.98913 | cell-cell signaling GO:0007267 |
| 2 | Q9NW15 | ANO10 | 0.88246 | transmembrane transport GO:0055085 transport GO:0006810 |
| 3 | Q6I9Y2 | THOC7 | 0.88225 | biological process involved in symbiotic interaction GO:0044403 cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 ... |
| 4 | Q96PH6 | DEFB118 | 0.85503 | cell adhesion GO:0007155 immune system process GO:0002376 reproduction GO:0000003 ... |
| 5 | Q5T3U5 | ABCC10 | 0.83176 | transmembrane transport GO:0055085 transport GO:0006810 |
| 6 | P30519 | HMOX2 | 0.80768 | catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 homeostatic process GO:0042592 ... |
| 7 | Q9UMW8 | USP18 | 0.80575 | catabolic process GO:0009056 cellular protein modification process GO:0006464 immune system process GO:0002376 ... |
| 8 | O43868 | SLC28A2 | 0.78151 | cellular nitrogen compound metabolic process GO:0034641 circulatory system process GO:0003013 homeostatic process GO:0042592 ... |
| 9 | Q8TBC4 | UBA3 | 0.78002 | biosynthetic process GO:0009058 cell cycle GO:0007049 cellular nitrogen compound metabolic process GO:0034641 ... |
| 10 | Q5TCS8 | AK9 | 0.76745 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 generation of precursor metabolites and energy GO:0006091 ... |
20 40 60 80 AA: MLSQKTKKKHNFLNHGLSLNLVIKPYLALEGSVAFPAENGVQDTESTLEKRETGDEENSAKFPIGRRDFDTLRCMLGRVYQRCWQV STMI: DO_DISOPRED3: DDDDDD...........................................DD.D................................. DO_IUPRED2A: D......................................DDDDDDDDDDDDDDDDDDDDDD......................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................... CONSENSUS: DDDDDD.................................DDDDDDDDDDDDDDDDDDDDDD......................... CONSENSUS_MOBI: .......................................DDDDDDDDDDDDDDDDDDDDD.......................... RICH_[E]: EstlEkrEtgdEE RICH_[ET]: TEsTlEkrET RICH_MOBI_[E]: EstlEkrEtgdEE