P48145 NPBW1_HUMAN
Gene name: NPBWR1
Protein name: Neuropeptides B/W receptor type 1
List of terms from Generic GO subset, which this protein is a part of:
- cell-cell signaling GO:0007267
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P15941 | MUC1 | 0.94492 | biosynthetic process GO:0009058 cell adhesion GO:0007155 cell cycle GO:0007049 ... |
| 2 | Q9NQ31 | AKIP1 | 0.89443 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 3 | P56746 | CLDN15 | 0.88492 | cell adhesion GO:0007155 cell junction organization GO:0034330 cellular component assembly GO:0022607 ... |
| 4 | Q96GV9 | MACIR | 0.87416 | cellular component assembly GO:0022607 protein transport GO:0015031 response to stress GO:0006950 ... |
| 5 | A6NH21 | SERINC4 | 0.81373 | biosynthetic process GO:0009058 |
| 6 | O43555 | GNRH2 | 0.81347 | anatomical structure development GO:0048856 reproduction GO:0000003 signal transduction GO:0007165 |
| 7 | Q93038 | TNFRSF25 | 0.80779 | cell death GO:0008219 signal transduction GO:0007165 |
| 8 | O14531 | DPYSL4 | 0.79947 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 ... |
| 9 | Q69YG0 | TMEM42 | 0.78087 | |
| 10 | Q14164 | IKBKE | 0.76877 | biological process involved in symbiotic interaction GO:0044403 cell death GO:0008219 cellular protein modification process GO:0006464 ... |
20 40 60 80 100 AA: MDNASFSEPWPANASGPDPALSCSNASTLAPLPAPLAVAVPVVYAVICAVGLAGNSAVLYVLLRAPRMKTVTNLFILNLAIADELFTLVLPINIADFLLR STMI: MMMMMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...... ........... ... CONSENSUS_MOBI: ..................................... ........... ... RICH_[AP]: AsfsePwPAnAsgPdPA
120 140 160 180 200 AA: QWPFGELMCKLIVAIDQYNTFSSLYFLTVMSADRYLVVLATAESRRVAGRTYSAARAVSLAVWGIVTLVVLPFAVFARLDDEQGRRQCVLVFPQPEAFWW STMI: MMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: ............ ......................... ....................... CONSENSUS_MOBI: ............ ......................... .......................
220 240 260 280 300 AA: RASRLYTLVLGFAIPVSTICVLYTTLLCRLHAMRLDSHAKALERAKKRVTFLVVAILAVCLLCWTPYHLSTVVALTTDLPQTPLVIAISYFITSLSYANS STMI: MMMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMM DO_DISOPRED3: ..........................................D.D..........D............................................ DO_IUPRED2A: .................................................................................................... DO_SPOTD: ..................................DDDDDDDDDDDDD..................................................... CONSENSUS: .. ..................DDD... .......... .. CONSENSUS_MOBI: .. ........................ .......... ..
320 AA: CLNPFLYAFLDASFRRNLRQLITCRAAA STMI: DO_DISOPRED3: ..........................DD DO_IUPRED2A: ............................ DO_SPOTD: ........................DDDD CONSENSUS: ..........................DD CONSENSUS_MOBI: ............................