Q9BUT9 MCRI2_HUMAN

Gene name: MCRIP2
Protein name: MAPK regulated corepressor interacting protein 2

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P35556 FBN2 0.82018 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...
2 Q3SXP7 SHISAL1 0.81651
3 P00748 F12 0.78025 immune system process GO:0002376
protein maturation GO:0051604
response to stress GO:0006950
4 P78381 SLC35A2 0.77204 carbohydrate metabolic process GO:0005975
small molecule metabolic process GO:0044281
transmembrane transport GO:0055085
...
5 Q5W150 n/a 0.76694
6 Q86XK2 FBXO11 0.76545 catabolic process GO:0009056
cell death GO:0008219
cellular protein modification process GO:0006464
...
7 Q13443 ADAM9 0.75916 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
catabolic process GO:0009056
...
8 Q9NWA0 MED9 0.74664 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
9 Q01826 SATB1 0.73483 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
...
10 O95944 NCR2 0.72531 immune system process GO:0002376
response to stress GO:0006950
signal transduction GO:0007165

                                           20                  40                  60                  80                 100
AA:                      MYTITKGPSKLVAQRRTGPTQQQVEGRLGELLKCRQPAPPTSQPPRAQPFAQPPGPWPLSSPGPRLVFNRVNGRRAPSTSPSFEGTQETYTVAHEENVRF
STMI:                                                                                                                        
DO_DISOPRED3:            ................................DDDDDDDDDDDDDDDDDDDDDDDDDDD...DDDDDDDDDDDDDDDDDDDDDDDDDDDD..........
DO_IUPRED2A:             D..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DD......
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................
RICH_[PQ]:                                                  QPaPPtsQPPraQPfaQPP                                              
RICH_[PR]:                                                                      PwPlssPgPRlvfnRvngRR                         
RICH_[P]:                                                    PaPPtsqPPraqPfaqPPgPwPlssPgP                                    
RICH_[Q]:                             QrrtgptQQQ            QpapptsQppraQpfaQ                                                
RICH_[R]:                                                                                RlvfnRvngRR                         
RICH_[T]:                  TiTkgpsklvaqrrTgpT                                                                                
RICH_[NR]:                                                                               RlvfNRvNgRR                         
RICH_fLPS_[P]:                                               PaPPtsqPPraqPfaqPPgPwPlssPgP                                    
RICH_MOBI_[PQ]:                                             QPaPPtsQPPraQPfaQPP                                              
RICH_MOBI_[P]:                                               PaPPtsqPPraqPfaqPPgPwPlssPgP                                    
RICH_MOBI_[Q]:                        QrrtgptQQQ            QpapptsQppraQpfaQ                                                
RICH_MOBI_[T]:             TiTkgpsklvaqrrTgpT                                                                                
RICH_MOBI_[LQ]:                              QQQvegrLgeLLkcrQ                                                                
RICH_fLPS_MOBI_[P]:                                          PaPPtsqPPraqPfaqPPgP                                            

                                          120                 140
AA:                      VSEAWQQVQQQLDGGPAGEGGPRPVQYVERTPNPRLQNFVPIDLDEWWAQQFLARITSCS
STMI:                                                                                
DO_DISOPRED3:            .................DD.........................................
DO_IUPRED2A:             ..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..D........................
DO_SPOTD:                ............DDDDDDDD....................................DDDD
CONSENSUS:               ............DDDDDDDD........................................
CONSENSUS_MOBI:          ............................................................