Q9BUW7 CI016_HUMAN

Gene name: C9orf16
Protein name: UPF0184 protein C9orf16

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9UI15 TAGLN3 0.64833 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
2 Q6NSZ9 ZSCAN25 0.64649
3 Q8IZR5 CMTM4 0.58669
4 Q8WZA9 IRGQ 0.57382
5 Q96DX5 ASB9 0.56954 catabolic process GO:0009056
cellular protein modification process GO:0006464
signal transduction GO:0007165
6 Q12979 ABR 0.55895 anatomical structure development GO:0048856
cell death GO:0008219
cell-cell signaling GO:0007267
...
7 Q9NWK9 ZNHIT6 0.55452 cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
protein-containing complex assembly GO:0065003
...
8 Q96F15 GIMAP5 0.54958
9 Q9UNE7 STUB1 0.54851 catabolic process GO:0009056
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
10 P31947 SFN 0.5483 anatomical structure development GO:0048856
cell cycle GO:0007049
cell death GO:0008219
...

                                           20                  40                  60                  80                 
AA:                      MSGPNGDLGMPVEAGAEGEEDGFGEAEYAAINSMLDQINSCLDHLEEKNDHLHARLQELLESNRQTRLEFQQQLGEAPSDASP
STMI:                                                                                                       
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDD......................................................D.DDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDD.................................................DDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDD.................................................DDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDD...........................................................
RICH_[EG]:                 GpnGdlGmpvEaGaEGEE                                                               
RICH_[GM]:               MsGpnGdlGM                                                                         
RICH_MOBI_[G]:             GpnGdlGmpveaGaeGeedGfG                                                           
RICH_MOBI_[M]:           MsgpngdlgM                                                                         
RICH_MOBI_[EG]:            GpnGdlGmpvEaGaEGEEdGfG                                                           
RICH_MOBI_[EM]:          MsgpngdlgMpvEagaEgEE                                                               
RICH_MOBI_[GM]:          MsGpnGdlGMpveaGaeG