P0DMB2 CH088_HUMAN
Gene name: C8orf88
Protein name: Uncharacterized protein C8orf88
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- translation GO:0006412
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9Y3C7 | MED31 | 0.98676 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell population proliferation GO:0008283 ... |
| 2 | Q9NVH2 | INTS7 | 0.9372 | biosynthetic process GO:0009058 cell cycle GO:0007049 cellular nitrogen compound metabolic process GO:0034641 ... |
| 3 | Q3MHD2 | LSM12 | 0.90822 | |
| 4 | O60437 | PPL | 0.88443 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 ... |
| 5 | Q9Y6H3 | ATP23 | 0.87374 | cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 DNA metabolic process GO:0006259 ... |
| 6 | A8MTZ0 | BBIP1 | 0.81238 | cellular component assembly GO:0022607 protein transport GO:0015031 transport GO:0006810 |
| 7 | O94886 | TMEM63A | 0.80859 | immune system process GO:0002376 transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 8 | P0C7V9 | METTL15P1 | 0.80728 | cellular nitrogen compound metabolic process GO:0034641 ribosome biogenesis GO:0042254 |
| 9 | A8K554 | ZNF815P | 0.773 | |
| 10 | Q9NRD0 | FBXO8 | 0.77061 | catabolic process GO:0009056 signal transduction GO:0007165 |
20 40 60 80 100 AA: METKKLIGKPLQPARPVRHLTSPPGAVFPFNFQNEYPCNTQCIQSGVSRCKTNGMQAFSQGLNEQQQQQSPVKKERIKYSRDFLLKLSSVSICRKKPDFL STMI: DO_DISOPRED3: D......................................................................D............................ DO_IUPRED2A: ..DDDDDDDDDDDDDDDDDD...................................DDDDDDDDDDDDDDDDDDD.......................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................... CONSENSUS: DDDDDDDDDDDDDDDDDDDD...................................DDDDDDDDDDDDDDDDDDD.......................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDD................................................................................ RICH_[Q]: QafsQglneQQQQQ RICH_fLPS_[Q]: QafsQglneQQQQQs
AA: PDHPIVLQKPENNQSFK STMI: DO_DISOPRED3: ............DDDDD DO_IUPRED2A: ..DDDDD..DDDD..DD DO_SPOTD: .........DDDDDDDD CONSENSUS: .........DDDDDDDD CONSENSUS_MOBI: .................