Q9BXT2 CCG6_HUMAN
Gene name: CACNG6
Protein name: Voltage-dependent calcium channel gamma-6 subunit
List of terms from Generic GO subset, which this protein is a part of:
- circulatory system process GO:0003013
- transmembrane transport GO:0055085
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | O43541 | SMAD6 | 0.89433 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
| 2 | Q13724 | MOGS | 0.86893 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 cellular protein modification process GO:0006464 ... |
| 3 | Q9UL41 | PNMA3 | 0.84378 | cell death GO:0008219 |
| 4 | Q9ULZ1 | APLN | 0.83952 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biological process involved in symbiotic interaction GO:0044403 ... |
| 5 | Q2TAM9 | TUSC1 | 0.82625 | |
| 6 | P0DP75 | MED14OS | 0.82498 | |
| 7 | Q86V81 | ALYREF | 0.82129 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 8 | Q9H7J1 | PPP1R3E | 0.81028 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 generation of precursor metabolites and energy GO:0006091 ... |
| 9 | Q6IPW1 | C11orf71 | 0.80998 | |
| 10 | P52198 | RND2 | 0.80516 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell morphogenesis GO:0000902 ... |
20 40 60 80 100 AA: MMWSNFFLQEENRRRGAAGRRRAHGQGRSGLTPEREGKVKLALLLAAVGATLAVLSVGTEFWVELNTYKANGSAVCEAAHLGLWKACTKRLWQADVPVDR STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .......D..DDDDDDDDDDDDDDDDDDDDDDD................................................................... DO_IUPRED2A: ................DDDDDDDDDDDDDDDD.................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................ CONSENSUS: .......DDDDDDDDDDDDDDDDDDDDDDDDDD......... ..................................... CONSENSUS_MOBI: .............DDDDDDDDDDDDDDDDDDDD......... ..................................... RICH_[AG]: GAAGrrrAhG RICH_[AR]: RRgAAgRRRA RICH_[G]: GaaGrrrahGqGrsG RICH_[R]: RRRgaagRRRahgqgR RICH_[GR]: RRRGaaGRRRahGqGRsG RICH_fLPS_[R]: qeenRRRgaagRRRahgqgR RICH_MOBI_[AG]: GAAGrrrAhG RICH_MOBI_[AR]: RRgAAgRRRA RICH_MOBI_[G]: GaaGrrrahGqGrsG RICH_MOBI_[R]: RRgaagRRRahgqgR RICH_MOBI_[GR]: RRGaaGRRRahGqGRsG RICH_fLPS_MOBI_[R]: RRgaagRRRahgqgR
120 140 160 180 200 AA: DTCGPAELPGEANCTYFKFFTTGENARIFQRTTKKEVNLAAAVIAVLGLAVMALGCLCIIMVLSKGAEFLLRVGAVCFGLSGLLLLVSLEVFRHSVRALL STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .......................................... ..... ........... CONSENSUS_MOBI: .......................................... ..... ...........
220 240 AA: QRVSPEPPPAPRLTYEYSWSLGCGVGAGLILLLGAGCFLLLTLPSWPWGSLCPKRGHRAT STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .......................................................DDDDD DO_IUPRED2A: ............................................................ DO_SPOTD: .....................................................DDDDDDD CONSENSUS: .................... ..............DDDDD CONSENSUS_MOBI: .................... ...................