Q9BYD5 CNFN_HUMAN
Gene name: CNFN
Protein name: Cornifelin
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9UF02 | CACNG5 | 0.70656 | cell-cell signaling GO:0007267 circulatory system process GO:0003013 nervous system process GO:0050877 ... |
| 2 | Q14586 | ZNF267 | 0.67763 | anatomical structure development GO:0048856 |
| 3 | P28069 | POU1F1 | 0.5351 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
| 4 | P57075 | UBASH3A | 0.51761 | immune system process GO:0002376 signal transduction GO:0007165 |
| 5 | Q9NQ33 | ASCL3 | 0.48694 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 6 | Q6ZNA1 | ZNF836 | 0.47885 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 7 | Q9BZ81 | MAGEB5 | 0.46452 | |
| 8 | Q9GZY0 | NXF2 | 0.41894 | anatomical structure development GO:0048856 nucleocytoplasmic transport GO:0006913 protein transport GO:0015031 ... |
| 9 | Q14990 | ODF1 | 0.39339 | anatomical structure development GO:0048856 cell differentiation GO:0030154 reproduction GO:0000003 |
| 10 | Q75L30 | n/a | 0.38979 |
20 40 60 80 100 AA: MSYPVTSQPQCATTSCYQTQLSDWHTGLTDCCNDMPVCLCGTFAPLCLACRISDDFGECCCAPYLPGGLHSIRTGMRERYHIQGSVGHDWAALTFCLPCA STMI: DO_DISOPRED3: D...DDDDDDDDDDDDD................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDD................................................................................ CONSENSUS: DDDDDDDDDDDDDDDDD................................................................................... CONSENSUS_MOBI: .................................................................................................... RICH_[CY]: YpvtsqpqCattsCY
AA: LCQMARELKIRE STMI: DO_DISOPRED3: ...........D DO_IUPRED2A: ............ DO_SPOTD: ..........DD CONSENSUS: ...........D CONSENSUS_MOBI: ............