Q9NQ33 ASCL3_HUMAN

Gene name: ASCL3
Protein name: Achaete-scute homolog 3

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P10747 CD28 0.58629 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
...
2 Q9UN30 SCML1 0.5391 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
3 P57739 CLDN2 0.53861 cell adhesion GO:0007155
cell junction organization GO:0034330
cellular component assembly GO:0022607
4 Q9ULM6 CNOT6 0.5316 biosynthetic process GO:0009058
catabolic process GO:0009056
cell cycle GO:0007049
...
5 Q9BYD5 CNFN 0.48694 anatomical structure development GO:0048856
cell differentiation GO:0030154
6 Q14990 ODF1 0.48336 anatomical structure development GO:0048856
cell differentiation GO:0030154
reproduction GO:0000003
7 Q13368 MPP3 0.45565
8 O15393 TMPRSS2 0.45355 biological process involved in symbiotic interaction GO:0044403
protein maturation GO:0051604
9 P31785 IL2RG 0.44453 biological process involved in symbiotic interaction GO:0044403
cellular protein modification process GO:0006464
immune system process GO:0002376
...
10 Q9UF02 CACNG5 0.43547 cell-cell signaling GO:0007267
circulatory system process GO:0003013
nervous system process GO:0050877
...

                                           20                  40                  60                  80                 100
AA:                      MDNRGNSSLPDKLPIFPDSARLPLTRSFYLEPMVTFHVHPEAPVSSPYSEELPRLPFPSDSLILGNYSEPCPFSFPMPYPNYRGCEYSYGPAFTRKRNER
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDD.....D....D.D....DD....DDDDD........DDDDDD.D.DDDDDDDDDDDDDDDDDDDDDDDDD........DDD
DO_IUPRED2A:             DDDDD..DDDDDD....................................D..........................................DD.D...D
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDD..DDDDDDDDDDDDDD.DDDDD.D..DDD.DDDDDDDDDDDDDDDDD...DDDDDDDDDDDDDDDD..........
CONSENSUS:               DDDDDDDDDDDDDDDDDDD..........DDD....DD....DDDD.........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........D
CONSENSUS_MOBI:          ....................................................................................................
RICH_[PY]:                                                                                 YsePcPfsfPmPYPnYrgceYsY           
RICH_[Y]:                                                                                              YpnYrgceYsY           
RICH_[CF]:                                                                                     CpFsFpmpypnyrgC               
RICH_[CP]:                                                                                    PCPfsfPmPyPnyrgC               
RICH_[CY]:                                                                                 YsepCpfsfpmpYpnYrgCeYsY           
RICH_[FP]:                                                                                    PcPFsFPmPyP                    
RICH_[FY]:                                                                                       FsFpmpYpnYrgceY             
RICH_fLPS_[Y]:                                                                                     fpmpYpnYrgceYsY           

                                          120                 140                 160
AA:                      ERQRVKCVNEGYAQLRHHLPEEYLEKRLSKVETLRAAIKYINYLQSLLYPDKAETKNNPGKVSSMIATTSHHADPMFRIV
STMI:                                                                                                    
DO_DISOPRED3:            DDD.................................................DDDDDDDDDDDDDDDDDDDDDDDDDD..
DO_IUPRED2A:             D..DDDDD.............................................DD...DDDDDDDD..............
DO_SPOTD:                ..................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               D...................................................DDDDDDDDDDDDDDDDDDDDDDDDDD..
CONSENSUS_MOBI:          ................................................................................