Q9BYE4 SPR2G_HUMAN

Gene name: SPRR2G
Protein name: Small proline-rich protein 2G

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell death GO:0008219
- cell differentiation GO:0030154

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P35326 SPRR2A 0.83147 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
2 P22532 SPRR2D 0.77132 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
3 Q5TA81 LCE2C 0.76539 anatomical structure development GO:0048856
cell differentiation GO:0030154
4 P22531 SPRR2E 0.76515 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
...
5 Q5TA79 LCE2A 0.7562 anatomical structure development GO:0048856
cell differentiation GO:0030154
6 P35325 SPRR2B 0.75161 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
7 O14633 LCE2B 0.75135 anatomical structure development GO:0048856
cell differentiation GO:0030154
8 A0A1B0GTR4 SPRR5 0.74379
9 Q96PI1 SPRR4 0.64892 anatomical structure development GO:0048856
cell differentiation GO:0030154
10 P22528 SPRR1B 0.64471 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
...

                                           20                  40                  60       
AA:                      MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPYLPPPCPPEHCPPPPCQDKCPPVQPYPPCQQKYPPKSK
STMI:                                                                                             
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....DDD
DO_IUPRED2A:             .........................................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....DDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDD.....................................................
RICH_[PQ]:                  QQQQckQPcQPPPvcPtPkcP                      PPPPcQdkcPPvQPyPPcQQ       
RICH_[C]:                       CkqpCqpppvCptpkCpepCpppkC        CppehCppppCqdkC                  
RICH_[P]:                          PcqPPPvcPtPkcPePcPPPkcPePylPPPcPPehcPPPPcqdkcPPvqPyPP          
RICH_[Q]:                   QQQQckQpcQ                                      QdkcppvQpyppcQQ       
RICH_[CP]:                      CkqPCqPPPvCPtPkCPePCPPPkCPePylPPPCPPehCPPPPCqdkCPPvqPyPPC         
RICH_[CQ]:                  QQQQCkQpCQpppvCptpkC                           CQdkCppvQpyppCQQ       
RICH_fLPS_[P]:                     PcqPPPvcPtPkcPePcPPPkcPePylPPPcPPehcPPPPcqdkcPPvqPyPP          
RICH_fLPS_[Q]:           msyQQQQckQpcQpppvcpt                                                     
RICH_fLPS_[C]:                  CkqpCqpppvCptpkCpepCpppkCpepylpppCppehCppppCqdkCppvqpyppC         
RICH_fLPS_[PC]:                    PCqPPPvCPtPkCPePCPPPkCPePylPPPCPPehCPPPPC                      
RICH_fLPS_[PCQ]:            QQQQCkQPCQPPPvCPtPkCPePCPPPkCPePylPPPCPPehCPPPPCQdkCPPvQPyPPCQQ       
RICH_MOBI_[PQ]:              QQQckQPcQPPPvcP                                                      
RICH_MOBI_[C]:                  CkqpCqpppvC                                                       
RICH_MOBI_[Q]:              QQQQckQpcQ                                                            
RICH_MOBI_[CP]:                 CkqPCqPPPvCP                                                      
RICH_MOBI_[CQ]:             QQQQCkQpCQpppvC                                                       
RICH_fLPS_MOBI_[Q]:      msyQQQQckQpcQpppvcpt                                                     
RICH_fLPS_MOBI_[QC]:     msyQQQQCkQpCQpppvCpt                                                     
RICH_fLPS_MOBI_[C]:      msyqqqqCkqpCqpppvCpt