Q96PI1 SPRR4_HUMAN

Gene name: SPRR4
Protein name: Small proline-rich protein 4

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 A0A1B0GTR4 SPRR5 0.73819
2 P22528 SPRR1B 0.67126 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
...
3 Q9BYE4 SPRR2G 0.64892 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
4 P35326 SPRR2A 0.62555 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
5 P49901 SMCP 0.61744 reproduction GO:0000003
6 P20336 RAB3A 0.60759 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell junction organization GO:0034330
...
7 A0A1B0GVQ3 CCDC200 0.60659
8 P22531 SPRR2E 0.59972 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
...
9 Q9ULV3 CIZ1 0.59668
10 P22532 SPRR2D 0.59508 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154

                                           20                  40                  60 
AA:                      MSSQQQQRQQQQCPPQRAQQQQVKQPCQPPPVKCQETCAPKTKDPCAPQVKKQCPPKGTIIPAQQKCPSAQQASKSKQK
STMI:                                                                                                   
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....................................DDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDD...DDDDD........................DD.DDD..........DDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................DDDDDD..........DDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[PQ]:                        QQQcPPQraQQQQvkQPcQP                                                  
RICH_[Q]:                   QQQQrQQQQcppQraQQQQvkQpcQ                                                   
RICH_[CP]:                           CPPqraqqqqvkqPCqP                                                  
RICH_[CQ]:                       QQQQCppQraQQQQvkQpCQ                                                   
RICH_fLPS_[Q]:              QQQQrQQQQcppQraQQQQvkQpcQ                                                   
RICH_MOBI_[PQ]:                     QcPPQraQQQQvkQPcQPPP                                                
RICH_MOBI_[PV]:                                VkqPcqPPPV                                               
RICH_MOBI_[C]:                       CppqraqqqqvkqpCqpppvkCqetCapktkdpC       CppkgtiipaqqkC            
RICH_MOBI_[K]:                                  KqpcqpppvKcqetcapKtK       KKqcppKgtiipaqqK             
RICH_MOBI_[P]:                        PPqraqqqqvkqPcqPPP                                                
RICH_MOBI_[Q]:              QQQQrQQQQcppQraQQQQvkQpcQpppvkcQ             QvkkQcppkgtiipaQQkcpsaQQaskskQ 
RICH_MOBI_[CI]:                                                       CapqvkkqCppkgtIIpaqqkC            
RICH_MOBI_[CK]:                                 KqpCqpppvKCqetCapKtK       KKqCppKgtiipaqqKC            
RICH_MOBI_[CP]:                      CPPqraqqqqvkqPCqPPPvkCqetCaP                                       
RICH_MOBI_[CQ]:                  QQQQCppQraQQQQvkQpCQ                 CapQvkkQCppkgtiipaQQkC            
RICH_MOBI_[IK]:                                                    KdpcapqvKKqcppKgtII                  
RICH_MOBI_[IQ]:                                                          QvkkQcppkgtIIpaQQ              
RICH_MOBI_[KQ]:                                                          QvKKQcppKgtiipaQQK             
RICH_fLPS_MOBI_[Q]:         QQQQrQQQQcppQraQQQQvkQpcQ                                   QQkcpsaQQaskskQ 
RICH_fLPS_MOBI_[QC]:        QQQQrQQQQCppQraQQQQvkQpCQpppvkCQetCapktkdpCapQvkkQC                         
RICH_fLPS_MOBI_[C]:                                CqpppvkCqetCapktkdpCapqvkkqC