Q8N9U9 SPOT1_HUMAN

Gene name: SPANXA2-OT1
Protein name: Putative uncharacterized protein SPANXA2-OT1

List of terms from Generic GO subset, which this protein is a part of:
- cell cycle GO:0007049
- cell death GO:0008219
- reproduction GO:0000003

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q8WW01 TSEN15 0.91247 cellular nitrogen compound metabolic process GO:0034641
mRNA processing GO:0006397
2 O14508 SOCS2 0.90647 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
...
3 Q96KJ9 COX4I2 0.90531 generation of precursor metabolites and energy GO:0006091
response to stress GO:0006950
4 Q96CM4 NXNL1 0.90083 homeostatic process GO:0042592
5 P17342 NPR3 0.89953 anatomical structure development GO:0048856
cell population proliferation GO:0008283
circulatory system process GO:0003013
...
6 Q8TDH9 BLOC1S5 0.89793 anatomical structure development GO:0048856
cell differentiation GO:0030154
cytoskeleton-dependent intracellular transport GO:0030705
...
7 Q9Y5Y6 ST14 0.89787 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell death GO:0008219
...
8 O96011 PEX11B 0.89231 signal transduction GO:0007165
9 Q9BYN0 SRXN1 0.88974 response to stress GO:0006950
10 Q6P575 GUSBP11 0.86803 carbohydrate metabolic process GO:0005975
catabolic process GO:0009056
small molecule metabolic process GO:0044281

                                           20                  40                  60                  80                 100
AA:                      MASPFGRLTDQKGRGHPAGSGGVEVNGGSARAAFSGGGRRVLSGGGRTAFGGGGRTAFGDGGRTAFGVGGRTAFGGGGRTAFGGGGRTAFGVGGRTAFGG
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDD.DD....DDD.D.........D.........................................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....DDDD....DDDD....DDDDDD...DDD.....DDD.....DDDDD...DDD.....DDD.....
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....DDDDDDDDDDDD.....................................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................................
RICH_[AG]:                             GhpAGsGGvevnGGsArAAfsGGG                                                              
RICH_[G]:                     GrltdqkGrGhpaGsGGvevnGGsaraafsGGGrrvlsGGG     GGGrtafGdGG                                      
RICH_[R]:                                              RaafsgggRRvlsgggR                                                     
RICH_[GR]:                                          GsaRaafsGGGRRvlsGGGR                                                     
RICH_fLPS_[G]:                       GrGhpaGsGGvevnGGsaraafsGGGrrvlsGGG     GGGrtafGdGG                                      
RICH_MOBI_[G]:                GrltdqkGrGhpaGsGGvevnGG                                                                        
RICH_MOBI_[GV]:                            GsGGVeVnGG                                                                        
RICH_fLPS_MOBI_[G]:              tdqkGrGhpaGsGGvevnGG                                                                        

                                          120   
AA:                      GERVSLLSPGWSALARSWLTASSASRVQAILLPQPPE
STMI:                                                         
DO_DISOPRED3:            ....................................D
DO_IUPRED2A:             .............................DDDDDDDD
DO_SPOTD:                ...................................DD
CONSENSUS:               ...................................DD
CONSENSUS_MOBI:          .....................................