Q9H0Q3 FXYD6_HUMAN

Gene name: FXYD6
Protein name: FXYD domain-containing ion transport regulator 6

List of terms from Generic GO subset, which this protein is a part of:
- circulatory system process GO:0003013
- transmembrane transport GO:0055085
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P35250 RFC2 0.82191 biosynthetic process GO:0009058
cell cycle GO:0007049
cellular nitrogen compound metabolic process GO:0034641
...
2 P61925 PKIA 0.75162 biosynthetic process GO:0009058
cell cycle GO:0007049
cellular nitrogen compound metabolic process GO:0034641
...
3 P09493 TPM1 0.74445 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell adhesion GO:0007155
...
4 Q86XW9 NME9 0.73276 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
homeostatic process GO:0042592
...
5 Q9NY72 SCN3B 0.72726 anatomical structure development GO:0048856
cell-cell signaling GO:0007267
circulatory system process GO:0003013
...
6 Q9NX24 NHP2 0.72726 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
chromosome organization GO:0051276
...
7 P09681 GIP 0.7086 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell-cell signaling GO:0007267
...
8 Q96C86 DCPS 0.69878 catabolic process GO:0009056
cell death GO:0008219
cellular nitrogen compound metabolic process GO:0034641
...
9 Q2KHN1 RNF151 0.69023 cell differentiation GO:0030154
cellular protein modification process GO:0006464
reproduction GO:0000003
10 Q02790 FKBP4 0.68994 anatomical structure development GO:0048856
cell differentiation GO:0030154
cellular component assembly GO:0022607
...

                                           20                  40                  60                  80     
AA:                      MELVLVFLCSLLAPMVLASAAEKEKEMDPFHYDYQTLRIGGLVFAVVLFSVGILLILSRRCKCSFNQKPRAPGDEEAQVENLITANATEPQKAEN
STMI:                    SSSSSSSSSSSSSSSSSS                 MMMMMMMMMMMMMMMMMMMMMMM                                     
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDD......................................................DDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ...........................................................................D.DDDDD.DD....D..DDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDD..................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:                                 DDDD.............                       .................DDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:                            .................                       ..........DDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[AE]:                                                                                          EAqvEnlitAnAtEpqkAE 
RICH_MOBI_[AE]:                                                                                ApgdEEAqvEnlitAnAtE      
RICH_MOBI_[N]:                                                                                           NlitaNatepqkaeN