Q9H0U6 RM18_HUMAN
Gene name: MRPL18
Protein name: 39S ribosomal protein L18, mitochondrial
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- translation GO:0006412
- transmembrane transport GO:0055085
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q96MK3 | FAM20A | 0.5336 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cellular protein modification process GO:0006464 ... |
| 2 | Q8TBR5 | CIRBP-AS1 | 0.51084 | |
| 3 | O60602 | TLR5 | 0.4723 | cell-cell signaling GO:0007267 immune system process GO:0002376 protein transport GO:0015031 ... |
| 4 | Q8N912 | NRAC | 0.46804 | |
| 5 | Q5T6M2 | LINC00242 | 0.46264 | |
| 6 | Q13507 | TRPC3 | 0.461 | homeostatic process GO:0042592 reproduction GO:0000003 response to stress GO:0006950 ... |
| 7 | Q99598 | TSNAX | 0.45924 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular nitrogen compound metabolic process GO:0034641 ... |
| 8 | O43559 | FRS3 | 0.44402 | cellular protein modification process GO:0006464 signal transduction GO:0007165 |
| 9 | Q4G0N7 | FAM229B | 0.44362 | |
| 10 | P51149 | RAB7A | 0.44319 | biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 cellular component assembly GO:0022607 ... |
20 40 60 80 100 AA: MALRSRFWGLFSVCRNPGCRFAALSTSSEPAAKPEVDPVENEAVAPEFTNRNPRNLELLSVARKERGWRTVFPSREFWHRLRVIRTQHHVEALVEHQNGK STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................................... DO_IUPRED2A: ........................D......DDDDDDDDDDDDDD.D..................................................... DO_SPOTD: DDDDD.DD.DDDDD..DDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................................. RICH_[AC]: CrnpgCrfAAlstssepAA RICH_[F]: FwglFsvcrnpgcrF RICH_[R]: RsRfwglfsvcRnpgcR RICH_[CF]: FwglFsvCrnpgCrF RICH_[CR]: RsRfwglfsvCRnpgCR RICH_MOBI_[AC]: CrnpgCrfAAlstssepAA RICH_MOBI_[F]: FwglFsvcrnpgcrF RICH_MOBI_[R]: RsRfwglfsvcRnpgcR RICH_MOBI_[CF]: FwglFsvCrnpgCrF RICH_MOBI_[CR]: RsRfwglfsvCRnpgCR RICH_MOBI_[FR]: RsRFwglFsvcRnpgcRF RICH_fLPS_MOBI_[F]: FwglFsvcrnpgcrF
120 140 160 AA: VVVSASTREWAIKKHLYSTRNVVACESIGRVLAQRCLEAGINFMVYQPTPWEAASDSMKRLQSAMTEGGVVLREPQRIYE STMI: DO_DISOPRED3: ...............................................................................D DO_IUPRED2A: ........................................................DDD..................... DO_SPOTD: ............................................................................DDDD CONSENSUS: ...............................................................................D CONSENSUS_MOBI: ................................................................................