Q9H2U6 CO005_HUMAN

Gene name: LINC00597
Protein name: Putative uncharacterized protein encoded by LINC00597

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q96L58 B3GALT6 0.93912 biosynthetic process GO:0009058
cellular protein modification process GO:0006464
small molecule metabolic process GO:0044281
2 Q5T9C9 PIP5KL1 0.91616 cell death GO:0008219
cellular protein modification process GO:0006464
3 Q8N6K7 SAMD3 0.90286
4 Q9GZY8 MFF 0.86513 anatomical structure development GO:0048856
cell death GO:0008219
protein targeting GO:0006605
...
5 Q13393 PLD1 0.86193 biosynthetic process GO:0009058
catabolic process GO:0009056
cellular component assembly GO:0022607
...
6 Q96LR9 APOLD1 0.848 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...
7 P41181 AQP2 0.84549 anatomical structure development GO:0048856
cellular component assembly GO:0022607
homeostatic process GO:0042592
...
8 A0A1B0GTL2 C20orf204 0.84215
9 Q9Y2T4 PPP2R2C 0.83761 cellular protein modification process GO:0006464
10 Q13868 EXOSC2 0.83205 catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
growth GO:0040007
...

                                           20                  40                  60                  80      
AA:                      MLKNRELLKIFEQASHMMKLIEEHCICDCIWMEWEDLEAKTLDRRPPEQTRRERCSCGNGKRWAKPKITTEKKNHPDFMIDWMYFETPLSIQMK
STMI:                                                                                                                  
DO_DISOPRED3:            DDDD..........................................................................................
DO_IUPRED2A:             .........................................DDDDD.DDDDDD..D.........DDD..........................
DO_SPOTD:                DDD.....................................DDDDDDDDDDDDDD.DDDDDDD........DD.....................D
CONSENSUS:               DDD......................................DDDDDDDDDDDDDDD......................................
CONSENSUS_MOBI:          ..............................................................................................
RICH_[R]:                                                           RRppeqtRReR