Q9H596 DUS21_HUMAN
Gene name: DUSP21
Protein name: Dual specificity protein phosphatase 21
List of terms from Generic GO subset, which this protein is a part of:
- cellular protein modification process GO:0006464
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9BZW8 | CD244 | 0.79262 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 immune system process GO:0002376 ... |
| 2 | Q96E93 | KLRG1 | 0.64717 | immune system process GO:0002376 response to stress GO:0006950 signal transduction GO:0007165 |
| 3 | Q9NXF8 | ZDHHC7 | 0.60971 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 4 | Q9P2H3 | IFT80 | 0.52282 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell population proliferation GO:0008283 ... |
| 5 | Q8N961 | ABTB2 | 0.52086 | |
| 6 | O15520 | FGF10 | 0.46456 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 7 | P31358 | CD52 | 0.46075 | homeostatic process GO:0042592 |
| 8 | Q96E29 | MTERF3 | 0.4599 | biosynthetic process GO:0009058 catabolic process GO:0009056 cellular component assembly GO:0022607 ... |
| 9 | Q9NRW7 | VPS45 | 0.43113 | protein transport GO:0015031 response to stress GO:0006950 transport GO:0006810 ... |
| 10 | Q8TBH0 | ARRDC2 | 0.43113 | protein transport GO:0015031 transport GO:0006810 |
20 40 60 80 100 AA: MTASASSFSSSQGVQQPSIYSFSQITRSLFLSNGVAANDKLLLSSNRITAIVNASVEVVNVFFEGIQYIKVPVTDARDSRLYDFFDPIADLIHTIDMRQG STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDD................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDD.................................................................................... CONSENSUS: DDDDDDDDDDDDDDDD.................................................................................... CONSENSUS_MOBI: .................................................................................................... RICH_[QS]: SaSSfSSSQgvQQ RICH_fLPS_[S]: taSaSSfSSS
120 140 160 180 AA: RTLLHCMAGVSRSASLCLAYLMKYHSMSLLDAHTWTKSRRPIIRPNNGFWEQLINYEFKLFNNNTVRMINSPVGNIPDIYEKDLRMMISM STMI: DO_DISOPRED3: .......................................................................................... DO_IUPRED2A: .......................................................................................... DO_SPOTD: ...................................................................................DDDDDDD CONSENSUS: .......................................................................................... CONSENSUS_MOBI: ..........................................................................................