Q9H609 ZN576_HUMAN
Gene name: ZNF576
Protein name: Zinc finger protein 576
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q01064 | PDE1B | 0.61966 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 ... |
| 2 | A4FU01 | MTMR11 | 0.61731 | |
| 3 | Q6PXP3 | SLC2A7 | 0.6062 | transmembrane transport GO:0055085 transport GO:0006810 |
| 4 | Q9BT04 | FUZ | 0.6062 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell differentiation GO:0030154 ... |
| 5 | Q53FP2 | TMEM35A | 0.6062 | |
| 6 | P49146 | NPY2R | 0.56492 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell-cell signaling GO:0007267 ... |
| 7 | P31994 | FCGR2B | 0.56285 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 cell adhesion GO:0007155 ... |
| 8 | Q9Y226 | SLC22A13 | 0.54484 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 immune system process GO:0002376 ... |
| 9 | Q8N402 | n/a | 0.54221 | |
| 10 | O95866 | MPIG6B | 0.53644 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell differentiation GO:0030154 ... |
20 40 60 80 100 AA: MEDPNPEENMKQQDSPKERSPQSPGGNICHLGAPKCTRCLITFADSKFQERHMKREHPADFVAQKLQGVLFICFTCARSFPSSKALITHQRSHGPAAKPT STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDD............................................................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDDDDDD.....................DDDDDDDDDDD........................D.DDDDDDDDDDDDDD DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................................DDD.... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................DDD.... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................................................... RICH_[EM]: MEdpnpEEnM RICH_[EP]: EdPnPEEnmkqqdsPkErsP RICH_[MN]: MedpNpeeNM RICH_MOBI_[M]: MedpnpeenM RICH_MOBI_[EM]: MEdpnpEEnMkqqdspkE RICH_MOBI_[MN]: MedpNpeeNM
120 140 160 AA: LPVATTTAQPTFPCPDCGKTFGQAVSLRRHRQMHEVRAPPGTFACTECGQDFAQEAGLHQHYIRHARGEL STMI: DO_DISOPRED3: ....................................................................DD DO_IUPRED2A: DDDDDD.....................DDDDDDD.................................... DO_SPOTD: .....................................................DDDDDDDDDDDDDDDDD CONSENSUS: ....................................................................DD CONSENSUS_MOBI: ......................................................................