Q53FP2 TM35A_HUMAN

Gene name: TMEM35A
Protein name: Transmembrane protein 35A

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P31994 FCGR2B 0.92848 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
cell adhesion GO:0007155
...
2 Q9Y226 SLC22A13 0.89877 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
immune system process GO:0002376
...
3 Q8N402 n/a 0.89443
4 O95866 MPIG6B 0.88492 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...
5 Q9H840 GEMIN7 0.86193 cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
mRNA processing GO:0006397
...
6 Q5QGZ9 CLEC12A 0.82531 immune system process GO:0002376
transport GO:0006810
vesicle-mediated transport GO:0016192
7 O95229 ZWINT 0.81923 cell cycle GO:0007049
cell division GO:0051301
chromosome organization GO:0051276
...
8 Q4KMG9 TMEM52B 0.78935
9 P29122 PCSK6 0.76194 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
...
10 Q96FZ7 CHMP6 0.74524 biological process involved in symbiotic interaction GO:0044403
catabolic process GO:0009056
cell cycle GO:0007049
...

                                           20                  40                  60                  80                 100
AA:                      MASPRTVTIVALSVALGLFFVFMGTIKLTPRLSKDAYSEMKRAYKSYVRALPLLKKMGINSILLRKSIGALEVACGIVMTLVPGRPKDVANFFLLLLVLA
STMI:                         MMMMMMMMMMMMMMMMMMMMM                                   MMMMMMMMMMMMMMMMMMMMM      MMMMMMMMMMMM
DO_DISOPRED3:            DDDDDDDDDDDDDDD.....................................................................................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                DDD.................................................................................................
CONSENSUS:               DDD..                     ...................................                     ......            
CONSENSUS_MOBI:          .....                     ...................................                     ......            

                                          120                 140                 160             
AA:                      VLFFHQLVGDPLKRYAHALVFGILLTCRLLIARKPEDRSSEKKPLPGNAEEQPSLYEKAPQGKVKVS
STMI:                    MMMMMMMMM     MMMMMMMMMMMMMMMMMM                                   
DO_DISOPRED3:            .....................................DDDDDDDDDDDDDDDDDDDDDDD...DD.D
DO_IUPRED2A:             .......................................DDDDDDDDDDDDDD..............
DO_SPOTD:                ..................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:                        .....                  .....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:                   .....                  ...DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[EP]:                                                       EkkPlPgnaEEqPslyEkaP