Q9HC23 PROK2_HUMAN
Gene name: PROK2
Protein name: Prokineticin-2
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- cell death GO:0008219
- cell population proliferation GO:0008283
- cellular protein modification process GO:0006464
- homeostatic process GO:0042592
- nervous system process GO:0050877
- reproduction GO:0000003
- response to stress GO:0006950
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P62945 | RPL41 | 0.8311 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 2 | P04085 | PDGFA | 0.71673 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 3 | Q96B42 | TMEM18 | 0.69885 | |
| 4 | Q7Z7J5 | DPPA2 | 0.66161 | |
| 5 | P01127 | PDGFB | 0.65988 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
| 6 | O60762 | DPM1 | 0.65465 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 small molecule metabolic process GO:0044281 |
| 7 | P33681 | CD80 | 0.65436 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
| 8 | Q9NUL7 | DDX28 | 0.65065 | cellular component assembly GO:0022607 protein-containing complex assembly GO:0065003 ribonucleoprotein complex assembly GO:0022618 ... |
| 9 | Q9Y3A4 | RRP7A | 0.63583 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cellular component assembly GO:0022607 ... |
| 10 | Q6IEG0 | SNRNP48 | 0.63293 | cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 |
20 40 60 80 100 AA: MRSLCCAPLLLLLLLPPLLLTPRAGDAAVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGKLGDSCHPLTRKNNFGNGRQERRKRKRSKRKKEVPFFG STMI: SSSSSSSSSSSSSSSSSSSSSSSSSSS DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDD......................................................DDDDDDDDDDDDD.......... DO_IUPRED2A: ..............................................................................DDDDDDDDDDDDDDDDDD.... DO_SPOTD: DDDDDDDDDDDDDDDDDDD....................................................DDDDDDDDDDDDDDDDDDDDDDDD..... CONSENSUS: ..................................................DDDDDDDDDDDDDDDDDD..... CONSENSUS_MOBI: ......................................................................... RICH_[R]: RqeRRkRkRskR RICH_[KR]: RqeRRKRKRsKRKK RICH_fLPS_[R]: gngRqeRRkRkRskR RICH_fLPS_[RK]: RqeRRKRKRsKRKK RICH_fLPS_[K]: rKrKrsKrKK
120 AA: RRMHHTCPCLPGLACLRTSFNRFICLAQK STMI: DO_DISOPRED3: ............................D DO_IUPRED2A: ............................. DO_SPOTD: ............................. CONSENSUS: ............................. CONSENSUS_MOBI: .............................