Q9HC23 PROK2_HUMAN

Gene name: PROK2
Protein name: Prokineticin-2

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- cell death GO:0008219
- cell population proliferation GO:0008283
- cellular protein modification process GO:0006464
- homeostatic process GO:0042592
- nervous system process GO:0050877
- reproduction GO:0000003
- response to stress GO:0006950
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P62945 RPL41 0.8311 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
2 P04085 PDGFA 0.71673 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
3 Q96B42 TMEM18 0.69885
4 Q7Z7J5 DPPA2 0.66161
5 P01127 PDGFB 0.65988 anatomical structure development GO:0048856
biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
...
6 O60762 DPM1 0.65465 biosynthetic process GO:0009058
cellular protein modification process GO:0006464
small molecule metabolic process GO:0044281
7 P33681 CD80 0.65436 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell adhesion GO:0007155
...
8 Q9NUL7 DDX28 0.65065 cellular component assembly GO:0022607
protein-containing complex assembly GO:0065003
ribonucleoprotein complex assembly GO:0022618
...
9 Q9Y3A4 RRP7A 0.63583 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cellular component assembly GO:0022607
...
10 Q6IEG0 SNRNP48 0.63293 cellular nitrogen compound metabolic process GO:0034641
mRNA processing GO:0006397

                                           20                  40                  60                  80                 100
AA:                      MRSLCCAPLLLLLLLPPLLLTPRAGDAAVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGKLGDSCHPLTRKNNFGNGRQERRKRKRSKRKKEVPFFG
STMI:                    SSSSSSSSSSSSSSSSSSSSSSSSSSS                                                                         
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDD......................................................DDDDDDDDDDDDD..........
DO_IUPRED2A:             ..............................................................................DDDDDDDDDDDDDDDDDD....
DO_SPOTD:                DDDDDDDDDDDDDDDDDDD....................................................DDDDDDDDDDDDDDDDDDDDDDDD.....
CONSENSUS:                                          ..................................................DDDDDDDDDDDDDDDDDD.....
CONSENSUS_MOBI:                                     .........................................................................
RICH_[R]:                                                                                                RqeRRkRkRskR        
RICH_[KR]:                                                                                               RqeRRKRKRsKRKK      
RICH_fLPS_[R]:                                                                                        gngRqeRRkRkRskR        
RICH_fLPS_[RK]:                                                                                          RqeRRKRKRsKRKK      
RICH_fLPS_[K]:                                                                                               rKrKrsKrKK      

                                          120           
AA:                      RRMHHTCPCLPGLACLRTSFNRFICLAQK
STMI:                                                 
DO_DISOPRED3:            ............................D
DO_IUPRED2A:             .............................
DO_SPOTD:                .............................
CONSENSUS:               .............................
CONSENSUS_MOBI:          .............................