Q96B42 TMM18_HUMAN

Gene name: TMEM18
Protein name: Transmembrane protein 18

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q15063 POSTN 0.70711 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell differentiation GO:0030154
...
2 Q9Y2E5 MAN2B2 0.70711 carbohydrate metabolic process GO:0005975
catabolic process GO:0009056
cellular protein modification process GO:0006464
...
3 Q9HC23 PROK2 0.69885 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell death GO:0008219
...
4 P62266 RPS23 0.66245 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
5 P04085 PDGFA 0.66129 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
6 O60762 DPM1 0.55216 biosynthetic process GO:0009058
cellular protein modification process GO:0006464
small molecule metabolic process GO:0044281
7 Q7Z7J5 DPPA2 0.54698
8 Q9H7R5 ZNF665 0.54677 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
9 P33681 CD80 0.53877 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell adhesion GO:0007155
...
10 Q5JQF7 LINC01556 0.53606

                                           20                  40                  60                  80                 100
AA:                      MPSAFSVSSFPVSIPAVLTQTDWTEPWLMGLATFHALCVLLTCLSSRSYRLQIGHFLCLVILVYCAEYINEAAAMNWRLFSKYQYFDSRGMFISIVFSAP
STMI:                                             MMMMMMMMMMMMMMMMMMMMM      MMMMMMMMMMMMMMMMMMMMM                  MMMMMMMMM
DO_DISOPRED3:            DDDDDDDD............................................................................................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                DDDDDD..............................................................................................
CONSENSUS:               DDDDDD...................                     ......                     ..................         
CONSENSUS_MOBI:          .........................                     ......                     ..................         

                                          120
AA:                      LLVNAMIIVVMWVWKTLNVMTDLKNAQERRKEKKRRRKED
STMI:                    MMMMMMMMMMMM                            
DO_DISOPRED3:            ................................DDDDDDDD
DO_IUPRED2A:             ...........................DDDDDDDDDDDDD
DO_SPOTD:                .........................DDDDDDDDDDDDDDD
CONSENSUS:                           ...............DDDDDDDDDDDDD
CONSENSUS_MOBI:                      ............................
RICH_[KR]:                                           RRKeKKRRRK  
RICH_fLPS_[R]:                                      eRRkekkRRR