Q9P0M4 IL17C_HUMAN

Gene name: IL17C
Protein name: Interleukin-17C

List of terms from Generic GO subset, which this protein is a part of:
- cell-cell signaling GO:0007267
- response to stress GO:0006950
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P0DN25 C1GALT1C1L 0.83774 biosynthetic process GO:0009058
cellular protein modification process GO:0006464
2 O43676 NDUFB3 0.75759 cellular component assembly GO:0022607
generation of precursor metabolites and energy GO:0006091
protein-containing complex assembly GO:0065003
3 Q8IW03 SIAH3 0.75759 anatomical structure development GO:0048856
catabolic process GO:0009056
protein targeting GO:0006605
...
4 P15515 HTN1 0.75651 anatomical structure development GO:0048856
immune system process GO:0002376
response to stress GO:0006950
5 Q9NP94 SLC39A2 0.75349 transmembrane transport GO:0055085
transport GO:0006810
6 Q15825 CHRNA6 0.73032 cell-cell signaling GO:0007267
nervous system process GO:0050877
signal transduction GO:0007165
...
7 Q9NUM3 SLC39A9 0.65191 transport GO:0006810
8 Q9HBV1 POPDC3 0.65049 anatomical structure development GO:0048856
cell differentiation GO:0030154
9 Q9UBV4 WNT16 0.65049 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell death GO:0008219
...
10 Q5M7Z0 RNFT1 0.64584 catabolic process GO:0009056
cellular protein modification process GO:0006464
response to stress GO:0006950

                                           20                  40                  60                  80                 100
AA:                      MTLLPGLLFLTWLHTCLAHHDPSLRGHPHSHGTPHCYSAEELPLGQAPPHLLARGAKWGQALPVALVSSLEAASHRGRHERPSATTQCPVLRPEEVLEAD
STMI:                    SSSSSSSSSSSSSSSSSS                                                                                  
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................................DDDDDDDDDDDDDDDDDDDDDDDD....
DO_IUPRED2A:             ......................DDDDDDDDDDD.DDDDDD................................D.DDDDDDDDDDDDDDDDDDDDD.....
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............D..DD........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:                                 DDDDDDDDDDDDDDD.......................................DDDDDDDDDDDDDDDDDDDDDDDD....
CONSENSUS_MOBI:                            ..................................................................................
RICH_[H]:                                  HHdpslrgHpHsH                                                                     
RICH_[R]:                                                                                           RgRheRpsattqcpvlR        
RICH_fLPS_[H]:                             HHdpslrgHpHsHgt                                                                   

                                          120                 140                 160                 180   
AA:                      THQRSISPWRYRVDTDEDRYPQKLAFAECLCRGCIDARTGRETAALNSVRLLQSLLVLRRRPCSRDGSGLPTPGAFAFHTEFIHVPVGCTCVLPRSV
STMI:                                                                                                                     
DO_DISOPRED3:            .................................................................................................
DO_IUPRED2A:             .......DD........................................................................................
DO_SPOTD:                .................................................................................................
CONSENSUS:               .................................................................................................
CONSENSUS_MOBI:          .................................................................................................