Q9NPD8 UBE2T_HUMAN
Gene name: UBE2T
Protein name: Ubiquitin-conjugating enzyme E2 T
List of terms from Generic GO subset, which this protein is a part of:
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- DNA metabolic process GO:0006259
- response to stress GO:0006950
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | Q8N8M0 | NAT16 | 0.88216 | |
2 | Q13451 | FKBP5 | 0.82699 |
cellular protein modification process
GO:0006464 protein folding GO:0006457 |
3 | Q9Y4C8 | RBM19 | 0.80904 |
anatomical structure development
GO:0048856 cellular nitrogen compound metabolic process GO:0034641 embryo development GO:0009790 ... |
4 | Q5SSJ5 | HP1BP3 | 0.80836 |
biosynthetic process
GO:0009058 cell population proliferation GO:0008283 cellular component assembly GO:0022607 ... |
5 | Q5T1B0 | AXDND1 | 0.79735 | |
6 | A0A1B0GVM5 | ETDC | 0.79258 | |
7 | A0AVF1 | TTC26 | 0.79257 |
anatomical structure development
GO:0048856 cell differentiation GO:0030154 cellular component assembly GO:0022607 ... |
8 | Q96P63 | SERPINB12 | 0.79257 |
anatomical structure development
GO:0048856 catabolic process GO:0009056 cell differentiation GO:0030154 ... |
9 | Q3ZM63 | ETDA | 0.79251 | |
10 | Q6ZNX1 | SHLD3 | 0.79243 |
anatomical structure development
GO:0048856 cellular nitrogen compound metabolic process GO:0034641 DNA metabolic process GO:0006259 ... |
20 40 60 80 100
AA: MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRP
STMI:
DO_DISOPRED3: D...................................................................................................
DO_IUPRED2A: .........DD..........DD.DDD.......DDDDD.............................................................
DO_SPOTD: DD..................................................................................................
CONSENSUS: D...................................................................................................
CONSENSUS_MOBI: ....................................................................................................
120 140 160 180
AA: SLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIEKKFHPDV
STMI:
DO_DISOPRED3: .........................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A: ..................DDD...DDDD................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........
DO_SPOTD: .....................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS: .....................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI: ......................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[E]: EEEmldnlpE
RICH_[K]: KrKasqlvgieKK
RICH_MOBI_[E]: EEEmldnlpE
RICH_MOBI_[K]: KrKasqlvgieKK