Q9NRJ3 CCL28_HUMAN

Gene name: CCL28
Protein name: C-C motif chemokine 28

List of terms from Generic GO subset, which this protein is a part of:
- cell adhesion GO:0007155
- homeostatic process GO:0042592
- immune system process GO:0002376
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q14CZ7 FASTKD3 0.62875 biosynthetic process GO:0009058
catabolic process GO:0009056
cellular component assembly GO:0022607
...
2 Q96RQ1 ERGIC2 0.61888 transport GO:0006810
vesicle-mediated transport GO:0016192
3 O43676 NDUFB3 0.61069 cellular component assembly GO:0022607
generation of precursor metabolites and energy GO:0006091
protein-containing complex assembly GO:0065003
4 Q8IW03 SIAH3 0.61069 anatomical structure development GO:0048856
catabolic process GO:0009056
protein targeting GO:0006605
...
5 Q6UXZ4 UNC5D 0.60697 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell death GO:0008219
...
6 Q75T13 PGAP1 0.60639 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cellular protein modification process GO:0006464
...
7 Q9NP94 SLC39A2 0.59883 transmembrane transport GO:0055085
transport GO:0006810
8 Q86XN6 ZNF761 0.55951 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
9 Q16880 UGT8 0.55945 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
10 O43490 PROM1 0.54656 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...

                                           20                  40                  60                  80                 100
AA:                      MQQRGLAIVALAVCAALHASEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCH
STMI:                    SSSSSSSSSSSSSSSSSSS                                                                                 
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDD...............................................................................
DO_IUPRED2A:             ...................................................................................DDDDD...DDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDD.......................................................................DDDDDDDDD
CONSENSUS:                                  D.......................................................................DDDDDDDDD
CONSENSUS_MOBI:                             .................................................................................
RICH_[H]:                                                                                                                   H
RICH_[K]:                                                                                                           KngKgnvch
RICH_[N]:                                                                                                            NgkgNvch
RICH_[HK]:                                                                                                             KgnvcH
RICH_[HN]:                                                                                                               NvcH
RICH_[KN]:                                                                                                          KNgKgNvch
RICH_fLPS_[H]:                                                                                                              H

                                          120             
AA:                      RKKHHGKRNSNRAHQGKHETYGHKTPY
STMI:                                               
DO_DISOPRED3:            .DDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ...........................
RICH_[H]:                rkkHHgkrnsnraHqgkHetygH    
RICH_[K]:                rKKhhgK                    
RICH_[N]:                rkkhhgkrNsN                
RICH_[HK]:               rKKHHgKrnsnraH             
RICH_[HN]:               rkkHHgkrNsNraH             
RICH_[HY]:                            HqgkHetYgHktpY
RICH_[KN]:               rKKhhgKrNsN                
RICH_fLPS_[H]:           rkkHHgkrnsnraHqgkHetygH