O43676 NDUB3_HUMAN
Gene name: NDUFB3
Protein name: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3
List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- generation of precursor metabolites and energy GO:0006091
- protein-containing complex assembly GO:0065003
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9NP94 | SLC39A2 | 0.98058 | transmembrane transport GO:0055085 transport GO:0006810 |
| 2 | Q9NUM3 | SLC39A9 | 0.88872 | transport GO:0006810 |
| 3 | Q7Z5A9 | TAFA1 | 0.82554 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell population proliferation GO:0008283 ... |
| 4 | Q96EU7 | C1GALT1C1 | 0.81597 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 5 | P05154 | SERPINA5 | 0.80192 | anatomical structure development GO:0048856 membrane organization GO:0061024 reproduction GO:0000003 ... |
| 6 | Q9P0M4 | IL17C | 0.75759 | cell-cell signaling GO:0007267 response to stress GO:0006950 signal transduction GO:0007165 |
| 7 | Q15319 | POU4F3 | 0.73849 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell death GO:0008219 ... |
| 8 | Q6UXZ4 | UNC5D | 0.72285 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell death GO:0008219 ... |
| 9 | Q9UKW6 | ELF5 | 0.70711 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 10 | A6NL99 | AQP7P3 | 0.70711 |
20 40 60 80 AA: MAHEHGHEHGHHKMELPDYRQWKIEGTPLETIQKKLAAKGLRDPWGRNEAWRYMGGFAKSVSFSDVFFKGFKWGFAAFVVAVGAEYYLESLNKDKKHH STMI: MMMMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDD.............................................................................DDDDDDDDD DO_IUPRED2A: DDDDDDDD..D....................................................................................... DO_SPOTD: DDDDDDDDDDDDD.............................................................................DDDDDDDD CONSENSUS: DDDDDDDDDDDD..................................................... ..DDDDDDDD CONSENSUS_MOBI: ................................................................. .......... RICH_[H]: HeHgHeHgHH RICH_fLPS_[H]: HeHgHeHgHH