Q9NRR8 C42S1_HUMAN

Gene name: CDC42SE1
Protein name: CDC42 small effector protein 1

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell morphogenesis GO:0000902
- signal transduction GO:0007165
- transport GO:0006810
- vesicle-mediated transport GO:0016192

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P55212 CASP6 0.69673 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
2 Q9UI15 TAGLN3 0.61537 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
3 P0C7Q2 ARMS2 0.60097 homeostatic process GO:0042592
4 P49069 CAMLG 0.59689 biological process involved in symbiotic interaction GO:0044403
catabolic process GO:0009056
cellular protein modification process GO:0006464
...
5 Q9H147 DNTTIP1 0.58485
6 Q96AM1 MRGPRF 0.57917 signal transduction GO:0007165
7 Q5U4P2 ASPHD1 0.57801 cellular protein modification process GO:0006464
8 Q96F15 GIMAP5 0.5731
9 O14744 PRMT5 0.5495 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell cycle GO:0007049
...
10 Q9NTK1 DEPP1 0.54759 catabolic process GO:0009056

                                           20                  40                  60 
AA:                      MSEFWHKLGCCVVEKPQPKKKRRRIDRTMIGEPMNFVHLTHIGSGEMGAGDGLAMTGAVQEQMRSKGNRDRPWSNSRGL
STMI:                                                                                                   
DO_DISOPRED3:            D....................................................................DD....DDDD
DO_IUPRED2A:             ...............DDDDDDDDDDDDDDDD....D....DD....DD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                .............DDDDDDDDDDDDDDDDDDDD.D.......DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               ...............DDDDDDDDDDDDDDDD...............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ...............................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[AG]:                                                               AGdGlAmtGA                     
RICH_[G]:                                                               GaGdGlamtG                      
RICH_[R]:                                                                               RskgnRdRpwsnsR  
RICH_[NR]:                                                                                  NRdRpwsNsR  
RICH_MOBI_[AG]:                                                          AGdGlAmtGA                     
RICH_MOBI_[G]:                                                          GaGdGlamtG                      
RICH_MOBI_[R]:                                                                          RskgnRdRpwsnsR  
RICH_MOBI_[GM]:                                                         GaGdGlaMtGavqeqMrskG            
RICH_MOBI_[NR]:                                                                             NRdRpwsNsR