Q9NRX2 RM17_HUMAN
Gene name: MRPL17
Protein name: 39S ribosomal protein L17, mitochondrial
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- translation GO:0006412
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P60509 | ERVPABLB-1 | 0.81373 | |
| 2 | Q8NE22 | SETD9 | 0.81373 | signal transduction GO:0007165 |
| 3 | Q8N7P3 | CLDN22 | 0.59985 | cell adhesion GO:0007155 cell junction organization GO:0034330 cellular component assembly GO:0022607 |
| 4 | P16415 | ZNF823 | 0.5754 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 5 | Q9BWL3 | C1orf43 | 0.55371 | transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 6 | Q9Y257 | KCNK6 | 0.54223 | circulatory system process GO:0003013 transmembrane transport GO:0055085 transport GO:0006810 |
| 7 | A8K554 | ZNF815P | 0.51081 | |
| 8 | Q9H9Q4 | NHEJ1 | 0.50546 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular nitrogen compound metabolic process GO:0034641 ... |
| 9 | Q15935 | ZNF77 | 0.49573 | |
| 10 | Q86XU0 | ZNF677 | 0.49299 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
20 40 60 80 100 AA: MRLSVAAAISHGRVFRRMGLGPESRIHLLRNLLTGLVRHERIEAPWARVDEMRGYAEKLIDYGKLGDTNERAMRMADFWLTEKDLIPKLFQVLAPRYKDQ STMI: TTTTTTTT DO_DISOPRED3: DDDD.....DD......................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDD.D................................................................................. CONSENSUS: .DD......................................................................................... CONSENSUS_MOBI: ............................................................................................
120 140 160 AA: TGGYTRMLQIPNRSLDRAKMAVIEYKGNCLPPLPLPRRDSHLTLLNQLLQGLRQDLRQSQEASNHSSHTAQTPGI STMI: DO_DISOPRED3: .........................................................DDDDDDDDDDDDDDDDDD DO_IUPRED2A: ...D...DD.............................................DDDDDDDDDDDDDDDDDDDDD DO_SPOTD: .......................................D................DDDDDDDDDDDDDDDDDDD CONSENSUS: ........................................................DDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ........................................................................... RICH_[HQ]: QsQeasnHssHtaQ RICH_[HS]: SqeaSnHSSH