A8K554 ZN815_HUMAN
Gene name: ZNF815P
Protein name: Putative protein ZNF815
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9Y3C7 | MED31 | 0.77765 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell population proliferation GO:0008283 ... |
| 2 | P0DMB2 | C8orf88 | 0.773 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412 |
| 3 | Q96SR6 | ZNF382 | 0.773 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 4 | Q5T5M9 | CCNJ | 0.76908 | cell cycle GO:0007049 cellular protein modification process GO:0006464 mitotic cell cycle GO:0000278 |
| 5 | Q9NVH2 | INTS7 | 0.72602 | biosynthetic process GO:0009058 cell cycle GO:0007049 cellular nitrogen compound metabolic process GO:0034641 ... |
| 6 | Q3MHD2 | LSM12 | 0.71676 | |
| 7 | O60437 | PPL | 0.68986 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 ... |
| 8 | P16473 | TSHR | 0.68409 | cell population proliferation GO:0008283 cell-cell signaling GO:0007267 homeostatic process GO:0042592 ... |
| 9 | Q9Y6H3 | ATP23 | 0.68048 | cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 DNA metabolic process GO:0006259 ... |
| 10 | Q9H9Q4 | NHEJ1 | 0.67587 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular nitrogen compound metabolic process GO:0034641 ... |
20 40 60 80 100 AA: MEEEEIRTWSFPEEVWQVATQPDSQQQHEDQHLSHTFLDKKDWTGNELHECNELGKKLHQNPNLLPSKQQVRTRDLCRKSLMCNLDFTPNAYLARRRFQC STMI: DO_DISOPRED3: DDDDDD.............................................................................................. DO_IUPRED2A: ...................DDDDDDDDDDDDDD.DDD................D....DD.DDDDD..DD.............................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: DDDDDD.............DDDDDDDDDDDDDDDDDD................D....DDDDDDDDDDDD.............................. CONSENSUS_MOBI: .................................................................................................... RICH_[Q]: QpdsQQQhedQ RICH_[HQ]: QpdsQQQHedQHlsH RICH_fLPS_[Q]: tQpdsQQQhedQhls
120 AA: DGHGNFFSVRNLKLHLQERIHAEVTSVEVL STMI: DO_DISOPRED3: .............................. DO_IUPRED2A: .............................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: .............................. CONSENSUS_MOBI: ..............................