Q9NSQ0 RRP7B_HUMAN

Gene name: RRP7BP
Protein name: Putative ribosomal RNA-processing protein 7 homolog B

List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- protein-containing complex assembly GO:0065003
- ribonucleoprotein complex assembly GO:0022618
- ribosome biogenesis GO:0042254

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q8N239 KLHL34 0.7151
2 P07196 NEFL 0.70075 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
...
3 O75461 E2F6 0.68897 biosynthetic process GO:0009058
cell cycle GO:0007049
cellular nitrogen compound metabolic process GO:0034641
...
4 Q8IVL6 P3H3 0.68056 biosynthetic process GO:0009058
cell population proliferation GO:0008283
cellular protein modification process GO:0006464
5 P59044 NLRP6 0.67287 catabolic process GO:0009056
cellular protein modification process GO:0006464
immune system process GO:0002376
...
6 O95990 FAM107A 0.66303 cell adhesion GO:0007155
cell cycle GO:0007049
cell junction organization GO:0034330
...
7 O15371 EIF3D 0.66053 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
cellular component assembly GO:0022607
...
8 Q03181 PPARD 0.65913 anatomical structure development GO:0048856
biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
...
9 P13805 TNNT1 0.65889 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...
10 Q969H6 POP5 0.65579 cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254

                                           20                  40                  60                  80                 100
AA:                      MEAYDQKIAEEEAKAKEEEGVPDEEGWVKVTRRGRRPVLPRTEAASLRVLERERRKRSQKELLNYAWQHRESKMEHLAQLRKKFEEDKQRIELLRAQRKF
STMI:                                                                                                                        
DO_DISOPRED3:            .........................D........DDDDDDDDDDDDDDDDDDD.DDDDDDDDD.....DD.D..DDD...............DDDDD...
DO_IUPRED2A:             ...DDDDDDDDDDDDDD.D.DD.DDDD....D.....DD.........DDD..........................DDD....................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDD............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................DDDDDDDD
CONSENSUS:               ...DDDDDDDDDDDDDDDD.D....D........DDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....DD......................DDDDD...
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDD...........................................................................
RICH_[AE]:                       AEEEAkAkEE                                                                                  
RICH_[AK]:                     KiAeeeAKAK                                                                                    
RICH_[E]:                         EEEakakEEE                                                                                 
RICH_[R]:                                                  RRpvlpRteaaslRvleReRRkR                                           
RICH_[EK]:                     KiaEEEaKaK                                                                                    
RICH_[ER]:                                                         EaaslRvlERERRkRsqkE                                       
RICH_[LR]:                                                             LRvLeReRRkRsqkeLL                                     
RICH_fLPS_[R]:                                             RRpvlpRteaaslRvleReRRkR                                           
RICH_MOBI_[AE]:           EAydqkiAEEEAkAkEEE                                                                                 
RICH_MOBI_[AK]:                KiAeeeAKAK                                                                                    
RICH_MOBI_[E]:            EaydqkiaEEEakakEEEgvpdEE                                                                           
RICH_fLPS_MOBI_[E]:               EEEakakEEEgvpdEE                                                                           

                                          
AA:                      RPY
STMI:                       
DO_DISOPRED3:            ...
DO_IUPRED2A:             ...
DO_SPOTD:                DDD
CONSENSUS:               ...
CONSENSUS_MOBI:          ...