Q9NWW0 HPIP_HUMAN

Gene name: HCFC1R1
Protein name: Host cell factor C1 regulator 1

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 O95972 BMP15 0.60985 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
2 Q8IZC7 ZNF101 0.6096 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
3 O00168 FXYD1 0.60372 cellular protein modification process GO:0006464
circulatory system process GO:0003013
transmembrane transport GO:0055085
...
4 P41181 AQP2 0.59488 anatomical structure development GO:0048856
cellular component assembly GO:0022607
homeostatic process GO:0042592
...
5 Q9BRK5 SDF4 0.59399 anatomical structure development GO:0048856
cell differentiation GO:0030154
transport GO:0006810
...
6 Q13393 PLD1 0.59034 biosynthetic process GO:0009058
catabolic process GO:0009056
cellular component assembly GO:0022607
...
7 Q9BY78 RNF26 0.58659 cellular protein modification process GO:0006464
immune system process GO:0002376
response to stress GO:0006950
8 O60437 PPL 0.57845 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
...
9 Q9HCB6 SPON1 0.56602 cell adhesion GO:0007155
cellular nitrogen compound metabolic process GO:0034641
protein maturation GO:0051604
10 P12018 VPREB1 0.5541 immune system process GO:0002376

                                           20                  40                  60                  80                 100
AA:                      MILQQPLQRGPQGGAQRLPRAALGVTWGLDASSPLRGAVPMSTKRRLEEEQEPLRKQFLSEENMATHFSQLSLHNDHPYCSPPMTFSPALPPLRSPCSEL
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDD.D..DDD.........DDD........................................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDD.D.................D.DDDDDDDDDDDDDDDDDDDDDDDD...........D.D...D..D.DDD..............
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................................
CONSENSUS_MOBI:          ....................................................................................................
RICH_[AG]:                           GGAqrlprAAlGvtwGldA                                                                     
RICH_[E]:                                                               EEEqEplrkqflsE                                       
RICH_[Q]:                   QQplQrgpQggaQ                                                                                    
RICH_[R]:                                                   RgavpmstkRRleeeqeplR                                             
RICH_[ER]:                                                  RgavpmstkRRlEEEqEplR                                             
RICH_[GQ]:                   QplQrGpQGGaQrlpraalG                                                                            
RICH_fLPS_[Q]:            ilQQplQrgpQggaQ                                                                                    

                                          120  
AA:                      LLWRYPGSLIPEALRLLRLGDTPSPPYPATPAGDIMEL
STMI:                                                          
DO_DISOPRED3:            ...........................DDDDDDDDDDD
DO_IUPRED2A:             ...............D....DDDDDDDDDDDDDDDD.D
DO_SPOTD:                .......................DDDDDDDDDDDDDDD
CONSENSUS:               .......................DDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ......................................