Q9NWW0 HPIP_HUMAN
Gene name: HCFC1R1
Protein name: Host cell factor C1 regulator 1
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | O95972 | BMP15 | 0.60985 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 2 | Q8IZC7 | ZNF101 | 0.6096 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 3 | O00168 | FXYD1 | 0.60372 | cellular protein modification process GO:0006464 circulatory system process GO:0003013 transmembrane transport GO:0055085 ... |
| 4 | P41181 | AQP2 | 0.59488 | anatomical structure development GO:0048856 cellular component assembly GO:0022607 homeostatic process GO:0042592 ... |
| 5 | Q9BRK5 | SDF4 | 0.59399 | anatomical structure development GO:0048856 cell differentiation GO:0030154 transport GO:0006810 ... |
| 6 | Q13393 | PLD1 | 0.59034 | biosynthetic process GO:0009058 catabolic process GO:0009056 cellular component assembly GO:0022607 ... |
| 7 | Q9BY78 | RNF26 | 0.58659 | cellular protein modification process GO:0006464 immune system process GO:0002376 response to stress GO:0006950 |
| 8 | O60437 | PPL | 0.57845 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 ... |
| 9 | Q9HCB6 | SPON1 | 0.56602 | cell adhesion GO:0007155 cellular nitrogen compound metabolic process GO:0034641 protein maturation GO:0051604 |
| 10 | P12018 | VPREB1 | 0.5541 | immune system process GO:0002376 |
20 40 60 80 100 AA: MILQQPLQRGPQGGAQRLPRAALGVTWGLDASSPLRGAVPMSTKRRLEEEQEPLRKQFLSEENMATHFSQLSLHNDHPYCSPPMTFSPALPPLRSPCSEL STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDD.D..DDD.........DDD........................................................ DO_IUPRED2A: DDDDDDDDDDDDDDDD.D.................D.DDDDDDDDDDDDDDDDDDDDDDDD...........D.D...D..D.DDD.............. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................... CONSENSUS_MOBI: .................................................................................................... RICH_[AG]: GGAqrlprAAlGvtwGldA RICH_[E]: EEEqEplrkqflsE RICH_[Q]: QQplQrgpQggaQ RICH_[R]: RgavpmstkRRleeeqeplR RICH_[ER]: RgavpmstkRRlEEEqEplR RICH_[GQ]: QplQrGpQGGaQrlpraalG RICH_fLPS_[Q]: ilQQplQrgpQggaQ
120 AA: LLWRYPGSLIPEALRLLRLGDTPSPPYPATPAGDIMEL STMI: DO_DISOPRED3: ...........................DDDDDDDDDDD DO_IUPRED2A: ...............D....DDDDDDDDDDDDDDDD.D DO_SPOTD: .......................DDDDDDDDDDDDDDD CONSENSUS: .......................DDDDDDDDDDDDDDD CONSENSUS_MOBI: ......................................